File: disney.jpg (64KB, 426x640px) Image search:
[Google]
64KB, 426x640px
How do I start with Disney comics? Since the ducktales thread talking about them I got interested
48 Posts / 31 Images
View this topic
>>
>>94137091
DON ROSA, all you need to know
https://en.wikipedia.org/wiki/List_of_Disney_comics_by_Don_Rosa
>>
Donald is better than Mickey
>>
>>94137671
Thanks, I`ve read life and times because someone did a storytime and it was glorious.
>>94138104
Any comic you recommend? The only thing about him that I have read is Pk.
File: 63546914.jpg (544KB, 1400x700px) Image search:
[Google]
544KB, 1400x700px
Which is your favorite version of the Penguin?
Personally, I like the half man half bird version of him.
27 Posts / 8 Images
View this topic
>>
>>94137087
Gotham version.
>>
>>94137139
lol
>>
File: Penguins.jpg (760KB, 1024x768px) Image search:
[Google]
760KB, 1024x768px
>>94137087
Have you ever thought that penguins from this image are probably fucking dead by now?
File: agent-carter-768.jpg (226KB, 768x1024px) Image search:
[Google]
226KB, 768x1024px
Season one
>high budget tightly paced serial drama
>little to no superpowers
>heavy focus on espionage
>40s style progressivism without being preachy
>every character is likable
>threatening bad guy
>fills in Black Widow back story
>team up with Howling Commandos
>Stark and Carter have actual character progression
>the best the MCU has to offer
Season two
>literal shit
How do you fuck up this badly?
19 Posts / 3 Images
View this topic
>>
File: 82ffe934aefad7294f9ccad8da5ae399.jpg (24KB, 250x350px) Image search:
[Google]
24KB, 250x350px
Here /co/, boobs. Now talk about Agent Carter
>>
>>94136796
Season 2 had promise but never really delivered. I dropped it towards the end. It's such a shame because Season 1 was great. Madam Masque was dope though, and Peggy continued being best MCU girl
>>
>>94136956
>yfw you'll never bury your face in Hayley Atwell's tits while she looks you right in the eye and does that lip bite.
Why live?
File: S6e15_Peppermint_Butler_with_Peace_Master's_kids.png (920KB, 1920x1080px) Image search:
[Google]
920KB, 1920x1080px
114 Posts / 15 Images
View this topic
>>
This one made me so mad I called someone to tell them how mad I was.
>>
>>94137128
Explain, I don't get it, I probably never saw this episode.
>>
>>94136776
Why this particular one? It was great, probably the show at its most morally ambiguous.
File: Big_Mike_KimPossible.jpg (77KB, 676x507px) Image search:
[Google]
77KB, 676x507px
This is Big Mike, for the past 15 years Rule 34 has not applied to him.
12 Posts / 8 Images
View this topic
>>
File: TickTickTick12.jpg (59KB, 600x338px) Image search:
[Google]
59KB, 600x338px
>>94136670
As you can clearly see, Big Mike is big
>>
File: TickTickTick13.jpg (49KB, 600x338px) Image search:
[Google]
49KB, 600x338px
In more ways than one.
>>
Commission it from Incog or somebody nigga
R34 still counts even if it's stick figures, draw it yoruself.
File: Candace_stating_her_mom_missed_seeing_all_the_Baljeets.jpg (78KB, 926x504px) Image search:
[Google]
78KB, 926x504px
>MOM, Phineas and Ferb are making a-
21 Posts / 11 Images
View this topic
>>
baby
>>
>>94136421
Delaware!
>>
File: PHINEAS AND FERB ARE MAKING A TITLE SEQUENCE.jpg (44KB, 476x468px) Image search:
[Google]
44KB, 476x468px
>>94136421
Anonymous
Order of the Stick 1085 - Omission Possible 2017-07-25 12:25:47 Post No.94136300
[Report] Image search: [Google]
Order of the Stick 1085 - Omission Possible 2017-07-25 12:25:47 Post No.94136300
[Report] Image search: [Google]
File: OotS 1085.png (435KB, 916x1194px) Image search:
[Google]
435KB, 916x1194px
Order of the Stick 1085 - Omission Possible
Anonymous
2017-07-25 12:25:47
Post No. 94136300
[Report]
[View this topic]
12 Posts / 2 Images
View this topic
>>
Isn't this usually posted on /tg/?
>>
>>94136332
Both, I think?
Like Dungeon meshi gets both /tg/ and /a/.
>>
Redcloak and Roy are the only reasons to read this
File: childrenofether.jpg (167KB, 640x981px) Image search:
[Google]
167KB, 640x981px
I'm going to assume this is /co/ because the creator is american trying to do american anime
https://www.youtube.com/watch?v=a5GS29oEdFk
How do you feel about Children of Ether?
33 Posts / 8 Images
View this topic
>>
File: DFLqI8xWsAI1st9.jpg (39KB, 854x480px) Image search:
[Google]
39KB, 854x480px
Really? No one?
>>
dang, LeSean Thomas is moving up
>>
File: 10420404_438121196348212_5359994248611131195_n.jpg (21KB, 625x351px) Image search:
[Google]
21KB, 625x351px
File: Ultimates_3_Vol_1_3_Textless_Frank_Cho_Variant.jpg (57KB, 527x800px) Image search:
[Google]
57KB, 527x800px
>MCU was allowed to use Scarlet Witch (and Quicksilver) as long as they didn't refer to them as muties
>Marvel Comics changes the origins of their powers so that they're no longer technically muties
Why must they be so butthurt?Also sleuth Wanda thread
72 Posts / 17 Images
View this topic
>>
File: 1500848986241.png (742KB, 791x1024px) Image search:
[Google]
742KB, 791x1024px
>>94136247
They're mad because they caused the crash in the 90's so they're snubbing people because """their""" """movies""" are successful as at the time selling the rights was what bailed them out.
But by doing so and not having to care about the state of their comics, they're likely going to cause another crash but will survive because those mousebucks will keep them afloat
>>
File: scarletwitchmarvelyearinreview.png (592KB, 500x678px) Image search:
[Google]
592KB, 500x678px
>>94136247
While Marvel has since changed who their parents are twice, Wanda and Pietro not being mutants anymore has to be a good thing for them.
>No-one will ever write comics about them being happy and relieved to not be mutants, and not having to deal with mutants and anti-mutant groups anymore.
>>
>>94136834
The extended Magneto family was a good thing Marvel had and they ruined it with this.
Wanda isnt a mutant anymore, because they dont want to confuse casuals who may buy a "Scarlet Witch" trade, after watching a Marvel movie.
File: hqdefault.jpg (10KB, 480x360px) Image search:
[Google]
10KB, 480x360px
>Hasn’t history proven that Marx’s vision of an egalitarian utopia is unattainable, inevitably creating an oligarchy more oppressive to the proletariat than the bourgeoisie it vilifies?
217 Posts / 43 Images
View this topic
>>
>>94136115
...shut up
>>
File: 1492892448.jpg (1B, 486x500px)
1B, 486x500px
>>94136115
>Marx’s vision of an egalitarian utopia is unattainable
>Marx
>egalitarian utopia
>he doesn't know Marx spent heaps of his time btfoing utopian socialists
baka read a book nigga
>>
We've gone... back in time.
File: Venom2.jpg (70KB, 300x410px) Image search:
[Google]
70KB, 300x410px
ITT design choices that trigger you
>Venom doesn't have spider symbol
>Venom doesn't have seemingly random squares on his hands
>Venom has monster feet and/or toes
12 Posts / 3 Images
View this topic
>>
File: bagleyvenom.jpg (274KB, 500x625px) Image search:
[Google]
274KB, 500x625px
Bagley Venom = best Venom
>>
>>94135883
>Bagley [Spider-Man character] = Best [Spider-Man character]
Fixed that typo for you.
>>
>>94135883
616 Bagley Venom. None of that Ultimate bullshit.
File: P00001.jpg (2MB, 1920x2969px) Image search:
[Google]
2MB, 1920x2969px
Good evening owls,
*************
69 Posts / 25 Images
View this topic
>>
File: P00002.jpg (3MB, 1920x2940px) Image search:
[Google]
3MB, 1920x2940px
>>94135696
I feel like I should be drunk for this
>>
>>94135765
Or on some kind of psychedelic drug, if I were 15 years younger.
>>
>>94135696
Hello, Storyteller.
>********
... Dare I ask?
Anonymous
Groening BTFOS Drumpf 2017-07-24 11:57:44 Post No.94135566
[Report] Image search: [Google]
Groening BTFOS Drumpf 2017-07-24 11:57:44 Post No.94135566
[Report] Image search: [Google]
File: 467975.jpg (127KB, 900x738px) Image search:
[Google]
127KB, 900x738px
http://www.huffingtonpost.com/entry/matt-groening-anti-trump-cheer_us_59740be0e4b00e4363dfefb6
49 Posts / 10 Images
View this topic
>>
>basically predicted trump winning 16 years ago
Ahh yes who could forget the simpsons episode where hillary beat bernie in the primaries before losing several swing states in the election.
>>
Max cringe, why do cartoonists and artists keep being vocal about their bullshit. Was anyone really sitting around and wondering "wow I wonder what the creator of the Simpsons thinks about trump!"
>>
>liberal humorist make fun of racist conservative
BREAKING NEWWWSSS!!
File: We're_gonna_build_a_rollercoaster.jpg (1MB, 1896x1068px) Image search:
[Google]
1MB, 1896x1068px
Phineas looks at an exact replica of the item to your left and says, "Ferb, I know what we're gonna do today!"
What are they doing today?
26 Posts / 4 Images
View this topic
>>
>>94135453
Staring at a wall.
>>
>>94135453
>Tablet I use almost exclusively to play Future Fight
Playing Future Fight I guess.
>>
A jar of pork floss
They're gonna make some chain restaurants brand about it
File: DFg9_OHU0AA6Gw8.jpg (42KB, 676x188px) Image search:
[Google]
42KB, 676x188px
Paramount is Fucking with Warner Bros wow Paramount cant even afford a fake mustache
30 Posts / 2 Images
View this topic
>>
How fucking stupid.
>>
>>94135215
They're jelly because they don't have a big franchise like Warner or Disney, they're fucking screwed so they do petty shit like this
>>
This got my blood boiling