what actually causes itchiness after shaving?
would you experience the same itchiness if you just cut the hair off with scissors, without scraping the skin?
2 Posts / 1 Images
View this topic
>>
your face is embarased for letting itself go for so long
could also be mad, we dont have the technology to tell yet
either way, take care of yourface and yourface will take care of you
Pic related. I really need help with which statistical method to use for analyzing data for the following:
>24 Subjects are given a survey where they will run into 3 possible, random scenarios (1, 2, or 3).
>For every scenario a subject encounters (1, 2, or 3), they must then answer 3 questions (Factor x, Factor y, and Factor z).
>Each Factor has a Likert scale using a 1 - 7 rating system.
The subjects will be doing this for 100+ times. I am interested in finding out what which scenarios produce the highest mean scores for every factor.
**Also**
>If I was comparing this information with 2 groups of 24 instead of one, what statistical method would I use If I wanted to see who had the lower overall factor scores for each scenario?
2 Posts / 1 Images
View this topic
>>
Side note: I don't think Chi Square or a repeated measures anova are appropriate for this, but could I be wrong?
File: 1487204285128.jpg (87KB, 736x671px) Image search:
[Google]
87KB, 736x671px
I've heard people say that any given electron, or what you would call an electron, is the same electron as all the electrons as all the other atoms in the universe. Is this true? Is this related to entanglement, or the holographic universe theory? Are we actually, all one, all connected?
4 Posts / 1 Images
View this topic
>>
https://en.wikipedia.org/wiki/Wheeler%E2%80%93Feynman_absorber_theory
is this what you're talking about?
>>
>>9141600
>https://en.wikipedia.org/wiki/Wheeler%E2%80%93Feynman_absorber_theory
I think I was just talking about this actually: https://en.wikipedia.org/wiki/One-electron_universe
>>
>>9141592
Yeah, its kinda fucky. The best argument I know is from thermo where because all electrons are EXACTLY the same and indistinguishable, switching two electrons will yield exactly the same observables.
As all observables are equal it's not possible to distinguish an electron from the other side of the universe switching places, and quantum doesn't forbid it.
File: 1-tdhl-GNrvT4EDJgB0XzuYA.png (3MB, 2000x1333px) Image search:
[Google]
3MB, 2000x1333px
what evolutionary factors led to this?
11 Posts / 3 Images
View this topic
>>
>>9141514
sex
>>
>>9141524
what do you mean? Did Spaghetti evolve from the sex? Or does it exist because we have sex?
>>
>>9141514
More a societal issue than a biological one desu
Anonymous
Martin Shkreli General 2017-09-01 03:53:21 Post No.9141480
[Report] Image search: [Google]
Martin Shkreli General 2017-09-01 03:53:21 Post No.9141480
[Report] Image search: [Google]
File: 1504232648423.png (624KB, 1040x1326px) Image search:
[Google]
624KB, 1040x1326px
>https://en.wikipedia.org/wiki/Protein_primary_structure#Notation
>It's HRC's DNA. He made it public to show the lab tech's working with the Chandra Levy investigation
Can any biofags confirm what this means?
7 Posts / 4 Images
View this topic
>>
File: 21268407_10210153318491299_1969866428_o.png (879KB, 1543x444px) Image search:
[Google]
879KB, 1543x444px
>>
LEFT VENTRICULAR CONNECTION DISCONNECTION EVENT DETECTED
ECHO NO CONNECTION TO ICD
PORT 8000 ESTABLISHED BY USER: SPEAKEASY
AUTOMATIC SWITCH OUTPUT ENABLED
EXOME SEQUENCE DUMP BEGIN
SEQ 1/25723
msgdemifdptmskkkrkkrkpfmldeeggdtqaeetqlsetkevepepvedkdteadeedsrkkdasndlddltffnqkkkkkktkkifdideaeegikdlkiegdaqepvepeddldimlgkkkkkktvkfpdedevldkdealededskkddgisfssqsgpawagserdytydellnrvfnimreknpdmvagekrkfvmkppqvvrvgtkktsfvnftdickllhrqpkhllafllaelgtsgsidgnnqlvikgrfqqkqienvlrryikeyvtchtcrspdtilqkdtrlyflqcetchsrcsvasiktgfqavtgkraqlrakan
SEQ 2/25723
meyrnlllgfllccillatsysymileekkdtnksavhtskikfpdlppisiveltktsmklsrkeaernksmkkkaqqkkaprpkpppppncvatwasckpssrpccdfcafcycrlfqtvcycrmgnpnc
SEQ 3/25723
mnseskkqlnivvlgtafmfmftafqtcgnvaqtvitnlnntdfhgsgytsmaviygvfsasnlispsvvaiigpqismfisgifysiyiaifiqpstwtfytasvflgiaaavlwtaqgncltvnsnehtigrnsgifwallqsslffgnlyiyfawqgkfhisesdrrtvfialtvislvgtvlfflirtpeesnseeeppadnlmertsgpsvmtkavdafkrsiklcatkeivllsvttaytgleltffsgvygtcigavnkfgneeksliglsgifigigeilgggifgllsksnqfgrnpvvmlgivvhfiafylifynipndapiasidgtdsrafmepskevaifcsfllglgdscfntqllsilgflysedsapafaifkfiqsvcaaiayfysnylflqwqllimavvgffgtisffsvewaapafvakrtdyssi
SEQ 4/25723
mqqlamsdtsaekphpshhstgavqmrirsvnsphdrhsqsksmilpenlkviepischrrnhsqhnltlpefispleqtvikegyllkakiadggkklrknwtsswlvltgqkiefykepkqpavanlkagyktewvdlrgahlewakeksskknvfqittlsgnevllqsdiefvilewfhaiknaieklpkekskmsrnneykimrssssellssfetdskepkpenrrslifrlnysisdtteinrvksrlkkfitrrpslrtlqekgiikgldvdgiyrvsgnlatiqklrfvvnqeeklnlddsqwedihvvtgalkmffrelpeplfpycffeqfvevikiqdytnrvkavrnlvqklprpnydtmkilfqhlqkiaakenmnlmtpqslgivfgptllrpeketgsmavymmyqnqlvelmlseyskifssekd
>>
madfnvgaaathfipgvspvpgsaavaadlsgskyngdkdvrdfhilrrnqpvillvivasfavgallrtilkrkkipilvivffigviigtsqlpfvktiaeidpvlflhlfspviiftaafemdfyifqksfwqvlilavlgfvmncaslgwltyktnqhkwtrddniifgiilcttdpdlsvasiknigiskilinlikgeslfngatttivfelyrdlvnhsyqkivqeifvkltlkifgsavfgfvsskmvtfwlanifndritevilsfsmtylvfylaewlgmsgiiavcvlgllmdsvsfspgmdvvlskfwsmltflaqimiyltmgiviaqktfpymnfhsifyivtiylslnliralvtfilspllnrfgygfnwrwgavivwsgvrglftlnmalevsqtpnensaeleiknmillysvavslltlvinsttveklvmtlglcnvslpkrvalhnafqrikqmeannftmlkldkfladanwalaekcisvedpkeidsvvkqlmktfrcpncnvntplensqqmadimeearlrlltaqiasyqkqynsgmlsqkatqtligaaecyydvpgkfmnihevkkywedkgllmsmkkylsdwaynvkpetsrtsenrflklcqlivyndtfehtsslitylnfipillrliptvnmeflpqlkicnyyflslyimeamlkiiamgrsyiryhwnkfdllviivgivdvmviniiraddrpygvvstvrvfrfirvlrllrllkhvvpkiiailerqinkqrsfcydiakgyiqaeedikclieqiaghekvcieinkileknkqdalkelglmqrdypdivtavktkqavqtvintdfqalqymisgcivdknegaelykiillkrkqlatlpptiapptapellrnvmwlcdnehqleyiqekakkicfdygdvvskegdlpqgihlivsgmvklsgstprygvynkeiekhlaatpytdylgtgtiigevncltkqemeytvtcetavqtcfisandlleafdtfletpsledkiwrkialdialktlkealpnqdwaykicaqfsnvqvvdipnhtkhdiydatmddvilvhgavqdcqlgqcyyapcilpktchqvrgnatvtkllvirttnrgaqtssevcnplcqyhssrrrealgnvfsahstspgsvttdpnnligqkdkkkkdssmckv
REMOTE DISCONNECTION EVENT DETECTED
SERVER PORT 8000 DISCONNECTED BY USER XVI
OUTPUT TERMINATED
KEEPALIVE PROCESS COMPLETE
RESUMING OUTPUT...
PORT 8000 DISCONNECTION DETECTED
RECONNECTING...
Anonymous
What's it like being a brainlet? 2017-09-01 02:19:21 Post No.9141353
[Report] Image search: [Google]
What's it like being a brainlet? 2017-09-01 02:19:21 Post No.9141353
[Report] Image search: [Google]
File: 1499546165136.png (1MB, 1250x1287px) Image search:
[Google]
1MB, 1250x1287px
What's it like being a brainlet?
Anonymous
2017-09-01 02:19:21
Post No. 9141353
[Report]
[View this topic]
Knowing that it isn't worth it to anyone for you to focus too intensely on any difficult problems we have as a species, that it's acceptable for you to just be a normie without any expectations other than be a half decent person. Seems like it would be heaven.
T smart guy who hates himself for not conquering the world yet
7 Posts / 1 Images
View this topic
>>
>>9141353
If you were actually a smart person, you would realize that everything you said applies as much to smart people as it does to dummies like you.
>>
>>9141353
that sounds horrible
normies only find that life acceptable because they don't think about it, they drown it out with social events and tv shows
>>
>>9141353
>he hasn't realized that brainlets lack empathy for other brainlets, much in the way he's demonstrated with his own post
You're just as bad as them, because you are them.
File: randomMath.jpg (33KB, 852x480px) Image search:
[Google]
33KB, 852x480px
Can /sci/ please help me with my problem?
I've tried for a week now and I don't know what's wrong. I'm trying to find another way to add an infinite sequence but for some reason the math tells me that any arbitrary sequence goes to infinity.
I think the problem has to do with my function a(n) but I'm not sure. Please /sci/, I've asked 4 professors and my school's math help center and none seem to know whats wrong and it's basic algebra. I'm sorry for being a brainlet.
Here's a link to my work:
drive.google.com/file/d/0B1jS6vwv3Y25X2tsb0VIdUJEX2s/view
3 Posts / 1 Images
View this topic
>>
>>9141329
guys..?
>>
>>9141340
Not a math guy so I'm not gonna check it, but heres a (you)
Is the universe mechanically perfect?
6 Posts / 1 Images
View this topic
>>
>>9141263
Define 'mechanically perfect' and this question might be meaningful
>>
>>9141263
Yes.
>>
File: 1427998290794.jpg (30KB, 500x359px) Image search:
[Google]
30KB, 500x359px
>Spacetime horseshit is 100% real and if you disagree you're a heretic
>The particle menagerie is 100% real and if you disagree you're a heretic
>The two theories contradict each other
Honestly, it's best to give up on humans at this point.
6 Posts / 3 Images
View this topic
>>
File: danascully.jpg (42KB, 522x640px) Image search:
[Google]
42KB, 522x640px
>>9141107
how dare you post mai waifu Scully and cluelessly insult modern verified models of physics in the same post
>>
File: 1503726331329.gif (2MB, 500x300px) Image search:
[Google]
2MB, 500x300px
>>9141117
good taste in waifus 10/10
>>
>>9141107
>>The two theories contradict each other
How so?
File: 1501260450453.jpg (38KB, 320x320px) Image search:
[Google]
38KB, 320x320px
Why are pre-med/dental/anything health related the most insufferable students?
>Always asking questions with obvious answers if you read/googled it, probably just seeking attention/validation
>Always talking about how the class has nothing to do with their field/major
>Always acting superior to everyone and smug
>Always kissing up to the professors
I hope these fucks wash out, they piss me off. Do professors notice this and how do they feel about these people?
>The Virgin Scientist vs The Chad/Stacy Healer
8 Posts / 2 Images
View this topic
>>
Med students are just social status climbers.
>>
File: Lucky-Star-Izumi-Konata-Hiiragi-Tsukasa-Takara-Miyuki-Girls-Witch-Costume-Hat-Cute-Background-Wallpaper-556206hd-220x176.jpg (34KB, 220x176px) Image search:
[Google]
34KB, 220x176px
>Yeah I'm going to school to be a doctor!!!!!
>I'm gunna be a surgeon!!!!
oh wow do go on
>>
>This class is nothing compared to anatomy
File: dbe2444ce0c1c828decc6ca8bd1adff9.jpg (73KB, 570x550px) Image search:
[Google]
73KB, 570x550px
>strings are the smallest things
>strings can be cut into pieces
8 Posts / 5 Images
View this topic
>>
File: tmp709096350347689986.jpg (285KB, 1240x787px) Image search:
[Google]
285KB, 1240x787px
>Societies like this never discovered electricity
>>
File: 1503780013340.jpg (24KB, 400x382px) Image search:
[Google]
24KB, 400x382px
>sub
>atomic
>particles
CAN'T MAKE THIS SHIT UP
>>
File: s-5077eee90c77ee6e7657f0010cd2a0a934e54826.jpg (29KB, 784x410px) Image search:
[Google]
29KB, 784x410px
>>9141087
>Only 3 forms of matter
u wot m8
File: 1495379454426.jpg (20KB, 496x372px) Image search:
[Google]
20KB, 496x372px
So I know that it could take like ten years just to master a single type of math so, my idea of competency isn't that but more the ability to do further research on a subject without being entirely lost
I want to do math, computer science, and electronics, and also learn about physics and maybe chemistry and use everything I've learned and work mostly with computers I guess.. Not sure if it would be more improving simulations or improving the computer itself. It seems with an advancement in hardware would naturally come with an advancement in software so it would take a really good understanding of both sides.
I've got a pretty high iq so I'm not worried about myself per se but I'm worried that it doesn't matter who you are, there's only so much one can learn in a space of time. But I'm also aware that there is much overlapping - to have a good knowledge of math would make learning physics and cs easier..
So yeah idk man is it just too much? Are there any ubermensche out there that know math physics and computers and actually apply what they know every day?
I guess I should include chemistry too as it obviously has a big influence on the development of computers.
My biggest worry is just my resources.. I'll be going to Ohio State University. I've learned almost everything I know about everything on my own, but I don't really believe it to be the most efficient way to learn. Worried that I might spend 5 years triple majoring in math physic and cs and ending up with a worthless triple meme degree
3 Posts / 2 Images
View this topic
>>
File: 5uAdmKX.png (120KB, 448x454px) Image search:
[Google]
120KB, 448x454px
>>9141067
triple major = shallow understanding of all three
i'd focus on one thing you like
also OSU sucks so try to transfer
>>
>>9141077
https://www.youtube.com/watch?v=Fns7NRSSQvc
WOIIIIIIIIIIIIIII
File: 1484518305639.jpg (139KB, 736x1088px) Image search:
[Google]
139KB, 736x1088px
http://www.telegraph.co.uk/science/2017/08/30/nanomachines-drill-cancer-cells-killing-just-60-seconds-developed/
So where were you when they developed light activated molecular killbots that spin at 2-3 million times per second? How far are we from a Grey Goo Scenario? Do you think serious nanoweapons are already under development by the various governments and militaries across the world? How do you stop a Grey Goo Scenario?
25 Posts / 6 Images
View this topic
>>
Grey goo would require nanobots that self-replicate. That's a lot more complicated than literally just spinning and nothing else.
We're probably about 10 or 20 years from "grey goo" being technologically possible
>>
>>9141080
That will never happen. It requires a lot more than that and we simply don't have the tech and never will.
>>
>>9141050
Humorous. Get back with me when humans can make a fucking normal sized robot with its own self-contained power source. Or a fucking phone batter that lasts longer than an hour.
>We star gods nao!
No, humans are just playing illusionist with their self-delusion 24/7 at this point.
Stylo (ID: !KlPtHCGW0k)
Creating Valid SAME Tones 2017-08-31 10:58:57 Post No.9141019
[Report] Image search: [Google]
Creating Valid SAME Tones 2017-08-31 10:58:57 Post No.9141019
[Report] Image search: [Google]
File: Fo4_Science!.png (27KB, 285x223px) Image search:
[Google]
27KB, 285x223px
Creating Valid SAME Tones
Stylo (ID: !KlPtHCGW0k)
2017-08-31 10:58:57
Post No. 9141019
[Report]
[View this topic]
/g/ isn't really paying this attention so reposting here
so /sci/, as of recent i've been thinking about how one would go about creating a valid SAME code, as in the ones used to broadcast a message using the EAS (Emergency Alert System), I want to know how to develop a string of code (Ex : ZCZC-ORG-EEE-PSSCCC+TTTT-JJJHHMM-LLLLLLLL-( Decoder attention code - Originator code - Event code - Location code - Purge time - Exact time of issue - Eight Character call sign -)) And produce those tones, not to cause an actual Alert Notification, but out of my own interest, could someone help shed some light on how I might go about this?
3 Posts / 1 Images
View this topic
>>
>>9141019
you're going to have to slow the fuck down and explain what exactly it is you are doing before you start posting spaghetti code in a paragraph of text you inbred
>>
>>9141436
This
File: stock-photo-angry-man-on-a-white-background-80310055.jpg (26KB, 450x330px) Image search:
[Google]
26KB, 450x330px
Can someone recommend a brainlet-friendly way to teach myself general physics / introductory physics? I'm not good at retaining information from dry textbooks, but I'm good at learning from doing practice problems online where it tells you what problems you missed and how to solve them.
2 Posts / 1 Images
View this topic
>>
youtube -> search for online lectures in undergrad physics -> browse some videos until you find a style that suits you -> follow them