http://www.7111317192329.com/
Well the countdown is gone now it redirects to a new page. With really fucked up noise.
http://sevens.exposed/
WTF is this shit.
>>18801642
What is happening?
>>18801652
Another countdown.
The noise is a pic.
>>18801937
They're not even trying anymore, are they?
your spectrum scale is off. there is text and an image of a Greek or roman statue along with something else I cant quite pick out. If you view source on the page and rip out the 2 audio files one is the steg image as audio with a bunch of text. The other is a piano melody with some reversed speech in it. any info on the images would be great.
the text is as follows
Momus hisses and wails, providing shelter for the dark Star and his companions, Lydia and the merchant of wine.
Beware false paths.
Birds of stealth, armor cloaked, now glint in the burning sun.
Seek solace not in the words of the priests but of the Oracle.
Chart the stars.
Liber Primus is the way.
Its numbers are the direction.
Good luck
>>18802244
>providing shelter for the dark Star and his companions
It's a fucking game of thrones arg.
Justin. Go there : https://discord.gg/btk3nn3
>>18802240
Link image please!
>>18804036
For you
>>18804957
Picture related :
1: Michelangelo Lodovico Buonarroti
2: Robert Fludd’s Temples of Music
3: Cicada
"Ursa Major will bite the triumphant hand which feeds it while the sloth of May decays in the garden of Europa. A lion will open the gates of hell, fighting serpents and ancient wraths as the shadow of humanity explodes into an apocalyptic spring."
This youtube channel just commented on my video https://www.youtube.com/channel/UC4htb2Lmt0nxlc0xO0qh3yQ/videos
The video they commented on was https://www.youtube.com/watch?v=nRe1exblxC0&lc=z13tgbyb4mazj3oka22xgd24asamczo14
Do you think it's just some bait channel or Cicada
>>18801937
>>18804957
>>18804966
Sentence to the left of the images which you excluded. It says:
Momus hisses and wails, providing shelter for the dark star and his companions, Lydia and the merchant of wine. Beware false paths. Birds of stealth, armour cloaked , now glint in the burning sun, Seek solace not in the words of the priests but of the oracle. Chart the stars. Liber Primus is the way , its numbers are the direction, Good Luck
>>18806703
>>18806767
>Beware false paths
>>18806770
that's what I figured considering the content seemed to be nothing but tripe.
>>18806770
>>18806703
>https://www.youtube.com/channel/UC4htb2Lmt0nxlc0xO0qh3yQ/videos
Hm. I wouldn't completely disregard it though or at least take a small closer look; this for instance features what sounds like another coded image from around 3:09: https://www.youtube.com/watch?v=jz8Ganduje4
>>18806875
theres a bunch on gibberish oin the comment section of this video. could be something, could not
>>18806875
>>18806897
also check out the channel that posted that video, they posted a bunch of other wierd shit over the last few weeks
>>18806897
>>18806915
Many of those vids seem to contain coded stuff. This one features codes in the subtitles.
https://www.youtube.com/watch?v=axPwp6nd-7w&feature=youtu.be
Could be a distraction though. Somebody ought to check it.
>>18806924
are you refering to "nobody nevamore puzzle sera7 subtitles are a blessing"?
also the channel is called "the 7" can't help but feel thats relevent somehow!
bumping for interest
talking about this here https://discord.gg/Tq7FAYG
if you show you are solving we have another one that's more focused
>>18807934
If this is still up in a day or two I might join. Thank you.
>>18807934
Are you working on the Liber Primus or are in contact with ppl who do?
>>18806703
https://www.youtube.com/watch?v=1elZr6tNUac
>>18807978
Lol. Ok fuck those guys.
>>18801634
Who cares about CICADA? only a bunch of smug faggots who think theyre so smart and want people to join their complex
Thinking - what is it? My mind is blank!
"Deeply thought" - Too much load, and the ship is sank?
O Captain! My Captain!? - But I do not care- or count any rank..
"Thoughtful ye bee" - but be sure as well act?
"captain stays till end" - thats a fact?
To have meaning.. But not to know it exact?
"complexity makes art" - complexes.. ..I have more than one!
"You are disqualified!!" - ..Let the past mistakes begone?
What is there to find? - What have found already?
Where will all this lead? To a group of even more autistic breed?
"A marvelous neutrality have these things Mathematical,
and also a strange participation between things supernatural,
immortal, intellectual, simple, and indivisible and things
natural, mortal, sensible, compounded, and divisible."
>>18801634
>WTF is this shit.
Garbage is what it is.
>>18809231
>>18810030
these right here
>>18806767
These are clues to a location. There are direct references to landmarks. Using stars for geographic directions. Could be off. But maybe it's pointing to something. I have no idea. Not familiar with the details of CICADA.
>>18810170
>birds of stealth, armour cloaked, now glint in the burning sun.
Sounds like a base with planes. Or a plane graveyard. The crap that builds up on the planes over time. Armor cloaked. Just speculation.
>>18805186
sloth of May in the garden of Europa sounds like Theresa May dragging her heels with Brexit
Birds of stealth, armour cloaked , now glint in the burning sun LUKE AIRFORCE BASE
I assume this is what you're supposed to do with that dial and lines.
>>18810791
here's a version with each line colored differently
Took a look at Whiteman afb and using a website to view constellations over the coordinates shows ursa major
>>18810865
Explain
>>18810877
Whiteman air force base is the only permanent base for the b-2 stealth bomber and it said chart the stars so I took a guess
itt: faggots indulging themselves on literally nothing
>>18810888
Anyone have Stellarium?
CICADA are probably watching this thread laughing their asses off watching y'all go around looking and clues that lead to a dead end.
>>18801634
What is the name of the song?
>>18806767
>Birds of stealth, armour cloaked, now glint in the burning sun
https://www.washingtonpost.com/world/national-security/cia-seeks-to-expand-drone-fleet-officials-say/2012/10/18/01149a8c-1949-11e2-bd10-5ff056538b7c_story.html
Interesting stuff. I wonder what it all means.
>>18811845
Nice find, thank you.
ok i put the things equal to the vigenerre chiper
and i got this : l*h;T+L
i put to google and i got these websites
http://www.aljyyosh.com/vb/showthread.php?t=9269
https://www.uschamber.com/sites/default/files/legacy/international/mideast/files/uschamberiraqbusinessinitativemission.pdf
ok its me again i got annother lead if you go to the first one website it is in arabic so the thread it lead to says this :
(Hello all how young
I am new to the site and I am a fan of Miko
Balch began a very easy gap
Just type it in Google
AAC video shows you how to hack through the loophole)
Creepy Rigtht
>>18809231
>>18814038
measure twice, cut once
>>18801634
>http://www.7111317192329.com/
Leads to seven.exposed now.
>three images embedded on site.
>four audio tracks to decode and decypher stuff from
Are they trying to recruit the unemployed? Fuck this. I'm out.
>>18815895
LOL Yes, our Cicada Overlords have been busy providing clues lately.
Here is one.
measure twice, cut once
That's the message in morse code at the start of the file
whatinput.wav
>>18815895
And more:
""The Feast of Assumption arrives. Time to go spelunking. Don't forget to bring a shovel. Find the cave in the desert, and return the spear. Then finish the puzzles, consult Liber Secundus. 22 is the Key. Z"
So, combine those two, we all need to be driving to the Mojave desert to lose our circumferences, find what is hidden in a cave and dig it up with a shovel (which might be the Spear of Destiny).
Now, supposedly, the Spear of Destiny is something very much worth having. Quite the treasure. I'd go, but I live nowhere near the desert.
>>18815660
Heh
has anyone found 3301's sig on any of this stuff?
>>18816025
No. People assume these are sub-groups or second gen cells doing this now.
Anyway the riddles and range of this is fantastic and a lot of people are in it for the journey alone or to "practice".
There is a new audio file on the sevens.exposed site and after running it through a spectogram, it reveals a new image with a cipher and a message about a spear and a desert
Also check out the relationship to WikiLeaks and tengri137.
>enjoy the classic music
>get scared
Thats what i get.
Wew
any significance to the filenames?
When you you time wasters get a fucking job?
>>18804957
Dumb question, what is that software you are using?
>>18815961
>>18815947
Hey there, we met in the other thread with the image of the fox in the OP. I made the OP.
Do you by any chance have a link to the original image of pic related that was found, the 22mb one, or do you know where I can find it? I would like to inspect it a bit.
Open question also, if anybody has a link where I can find it, please let me know.
>>18817246
Lol. Stay mad faggot.
>>18817434
I think the software is "Audacity" Might be mis-spelled. Check google. Supposedly open source and free to download.
>>18817648
Sorry, I missed your OP on the other thread. Um, the original image from 05 Jan 2017? Honestly, no. One thing is that Cicada tends to delete past clues once they are "solved." I am not sure why. Check this past thread. Maybe one of those links will get you to the original image.
https://archive.4plebs.org/x/thread/18491379/
I know that various solvers have saved it variously around the web in dropboxes and the like. I just have no access to them.
>>18817029
>>18817929
https://upload.wikimedia.org/wikipedia/commons/thumb/1/1b/ANGELICO%2C_Fra_Annunciation%2C_1437-46_%282236990916%29.jpg/550px-ANGELICO%2C_Fra_Annunciation%2C_1437-46_%282236990916%29.jpg
What the fuck are ya'll even doing? This shit is for nothing! It's a fucking cicada 3301 copy!
>>18804957
Vaporwave af
>>18817648
A FOLLOW UP:
As i said last night, GO HERE:
https://archive.4plebs.org/x/thread/18491379/
Many know this, but just in case: Under the original image in the archives, there are tiny icons. The right-most icon gives you a "bigger" version of the Original Post ("OP") image. In theory, that might be the original original Cicada image, but I am not sure. It has the file name 7.png.
If you (or anyone) wants to practice with original Cicada files, there are some current ones available. http://sevens.exposed/
That is the current (as of 26 Mar) website. Right now there is a cipher wheel, three "arms" and text. It has changed many times since the 05 Jan 2017 start.
The so called Apocalypse Song is still available too. http://sevens.exposed/31417.mp3
It is 19:26 minutes. I am sure someone has completely deconstructed the audio into all the pieces, but I have not seen a complete deconstruction of it.
So, if someone wants to use Audacity
>>18819019
or maybe (?) Vaporwave (?), have fun ! Maybe there are clues that were missed.
The current website has new music. The file name is TheFluddApproaches.wav.
There are noises, maybe Morse Code?, seems to be some backwards audio too (or at least something that seems like mangled speech).
Again, this is good practice even if someone has already completely deconstructed the audio. What can you find?
Music can be converted to numbers. I don't know how.
Might be of help (might not):
https://academo.org/demos/spectrum-analyzer/
http://sevens.exposed/AMessage.zip
open the .wav in notepad++
So basically I found a zip folder and one of the results is this :
@Cicada
charthestarsACssaartAharhCCGchtchCasrAatrrsGCsCaCThCtaCAhrah
+
cCaACctCcarsaraCAaraGtCcaTCahcsTarhCrTcAcGhrssaCssrAhaCcAThC
@VMAT2
PIIPSYLYSIKHEKNATEIQTARPVHTASISDSFQSIFSYDNSTMVTGNATRDLTLHQTA
+
TQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKATVQLITNPFIGLLTSRIGYPIPI
Also there is another file with a giant image with @ And + symbols and the golden ratio number at the bottom.
In the other part of the zip there is a file with the complete genome of Candidatus Hodgkinia cicadicola Dsem
So basically I found a zip folder and one of the results is this :
@Cicada
charthestarsACssaartAharhCCGchtchCasrAatrrsGCsCaCThCtaCAhrah
+
cCaACctCcarsaraCAaraGtCcaTCahcsTarhCrTcAcGhrssaCssrAhaCcAThC
@VMAT2
PIIPSYLYSIKHEKNATEIQTARPVHTASISDSFQSIFSYDNSTMVTGNATRDLTLHQTA
+
TQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKATVQLITNPFIGLLTSRIGYPIPI
Also there is another file with a giant image with @ And + symbols and the golden ratio number at the bottom.
In the other part of the zip there is a file with the complete genome of Candidatus Hodgkinia cicadicola Dsem
>>18805186
The Battle of Evermore.
>>18822088
Add something to the conversation?
>>18801634
Does anyone else gete a major SEELE vibe from this?
Third Impact is Nigh
>>18822128
If you insist.
https://www.youtube.com/watch?v=AENMnjmf7I4
Z gave them the coordinates, they are headed there now.
>>18822142
No. Come back when you're 18.
Hey I was away all weekend. I want to catch up and lurk. Can someone link the discord all the youtubers are using?
Defango is off to find the Spear of Destiny today.
This first one is about a new supposed encryption that uses DNA sequencing.
ps://www.youtube.com/watch?v=Mo9Hr9RDfsc [Embed]
see around the 4:30 mark.
Here is Defanfo on his way to find the Spear of Destiny.
https://www.youtube.com/watch?v=pCfzrTlLdbk [Embed]
There are probably thousands of Discord Boards. You get an invite to one by doing something useful in a public forum like this one. Get off your *ss. Grin.
off to work.
Sorry, meant to post the image with the last comment.
>>18817246
>be intelligent
>got to work 9-5
Seems like the AMessageOfHope.wav is a star chart of April 2017's sky. If phi after the image can be connected to astrology, it would be Venus, which will enter pisces
In the "AMessageOfReason.fastq" file it talks about VMAT2, which according to this Wiki article: https://en.wikipedia.org/wiki/God_gene
Is the God gene, just wanted to throw that in there
Famous caves in the Mojave desert.
>>18823489
Hey friend, me >>18817648 again, having a question for you: Around 8:05 min into the first of the two links you posted he starts talking about an Economist article from 1988 titled "The Phoinix".
Where was the lead to this?
Thanks for doing this, btw.
Also bump.
MDEwMTAxMDAgMDExMDEwMDAgMDExMDAxMDEgMDAxMDAwMDAgMDEwMTAwMTEgMDExMTAwMDAgMDExMDAxMDEgMDExMDAwMDEgMDExMTAwMTAgMDAxMDAwMDAgMDExMDEwMDAgMDExMDAwMDEgMDExMTAwMTEgMDAxMDAwMDAgMDExMDAwMTAgMDExMDAxMDEgMDExMDAxMDEgMDExMDExMTAgMDAxMDAwMDAgMDExMTAwMDAgMDExMDExMDAgMDExMDAwMDEgMDExMDAwMTEgMDExMDAxMDEgMDExMDAxMDAgMDAxMDExMTA=
>>18825634
bump
>>18824091
someone found the spear
>bump
>>18801634
ending with static is most likely a message hidden through Steganography
I have found that the @VMAT2 sequence in the fastq file is only 60 chars long, the line after the + is actually the continuation of the sequence up to 120 chars. Perhaps this is a hint. Also opening the file in a rich-text editor shows some characters being udnerlined
>>18826027
Where?
>>18827758
Cool, I can't wait to get back home and mess with it more, that's what I was onto before I went out. My computer crashed basically when I tried to parse the FastA file cause it's so large
>>18826027
Image of said spear reverse searches to pleb archive
>>18828064
Amazing. Fucking amazing.
>>18827758
>>18828047
>>18828112
Got it I think hopefully. Check this.
http://imgur.com/ZoE2zk4
Try Eminem's album in 98, the year I was born. Big L's 98 freestyle too.
I'm infinite, you heard of hell well I was sent from it, went to it serving a sentence for murdering instruments. Now I'm trying to repent from it, because when I hear the beat I'm tempted to make another attempt at it I'm infinite.
Hope you all like my music.
>>18823999
>>18806767
>Chart the stars.
>>18828207
Its literally mathematical proof of infinity. I can only imagine what the biological data in the FASTa file adds up to.
>>18826027
What? How and where?
>>18828222
If anon is referring to Defango there was someone on Twitter who claimed they found it. Someone in the comments said the image posted reversed back to 4plebs archive.
So in other words no one has found shit
>>18828241
In other words, it all comes back to archived posts on 4chan. Me calling myself the meme lord specifically solving these puzzles. The guy on twitter calls himself the Kek HQ basically doing it all for me. I am the circular logic behind all of it because I perpetuate it. Thats why I was able to solve the VMAT as infinity.
The grand scheme is a retardedly huge meme that seems dumb but its actually brilliant and awesome. This is what Split was about basically, mental patients having full power of the mind. Delusion = de-illusion.
Thats why every one is getting scared calling people mental patients but my reality is clearly all of yours as well. Why Split 2 is lining up to be the beast of many forms who thinks he is what he is vs Bruce Willis, the true unbreakable who was living in his own happiness the whole time, exactly as I said from my very first thread a month ago. I play it off as a meme but its actually a really complicated play basically. It may or may not be my specific part but I know I have a lot of power as this board and the internet has shown me. That was my hypothesis the whole time, God needing the power of belief that is of his heart.
Theres some beauty in those pirates of the caribbean scenes where jack sparrow gets davy jones heart in his hands and puts it in a jar of dirt. Thats what god has been, a heart beating in a jar of dirt at the hands of some (admittedly awesome and amazing) pirate turning the actuality ugly.
>>18828270
This is all just my speculation by the way but it seems like my speculation specifically is painting all of our portraits so I don't about being modest I'll just throw it out there for all to see
>>18828270
I just meant the Kek account was a troll... Not sure why Defango would waste time recording another video instead of just reverse searching that image himself.
Anyways, his last video is about the internet privacy bill going to the House today.
The puzzle continues IMO
>>18828270
I hope you're memeing here... Because if not, you should really take a break and slow down a little, anon. You sound manic. Slow down.
>>18828452
I'll say this: If you don't get the math behind any of this then you clearly shouldn't be talking, and if you do then I want to ask why you say what you said? I want to ask before I just go ahead and answer.
>>18828531
The math it's more of a distraction of the real message than the message itself.
>>18828536
I know thats why I solved it entirely in a day or two without ever even knowing about it before. Trust me I know, I'm basically trying to get this math shit out of the way so the world can believe in some thing greater.
>>18828539
stop jerking yourself off anon
we all know your lying
we all know you didnt solve any of themath
we all know you just combed through the threads and read about other people solving the math
Really tired of seeing this thread.
>>18828560
then go back to divination general
>>18828556
See this is the exact shit. I don't give a fuck what I am or what any of you think I am because I all ways am regardless. You literally are too ignorant to get any of this and have no idea what you're talking about yet will still go to any lengths to try to gaslight me as being crazy.
Are you a scared shill or an ignorant peasant? Or both? Trust me I understand a lot about how this works, you are the one speaking for "we" outting them self as knowing nothing. I would get mad and say fuck off but I don't even have to.
http://imgur.com/a/0FDYE
Read it and weep. Call me crazy all day, my word and belief will never sway I'm here to stay, I eat red crabs like you with Old Bay and sweep the dirt of the streets like Nick Cage ya dont say. Sweet, meme lord out, peace.
>>18828604
Good shit.
>>18828560
Then start a better one or GTFO
>>18828220
>>18828207
I think the data is too large, thus infinity, the FASTA file is a legit genome sequence, doubt there's anything to decode in it, unless God itself put it there and told 3301 the key :D
>>18827758
No underlines, the files turned out to be plain-text, Kate in linux figured out the fastq format and decided to underline stuff (wonder why). My PC is leading me to false paths!!! *paranoid*
>>18828797
The inital message in the q file is just
"@VMAT2
PIIPSYLYSIKHEKNATEIQTARPVHTASISDSFQSIFSYDNSTMVTGNATRDLTLHQTA
+
TQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKATVQLITNPFIGLLTSRIGYPIPI"
It is then deciphered as "Infinity", 3301 repeating in hexadecimal form. 3301 is the decryption of infinity so to speak. I can decode the genome bit by bit but its too much for my hardware at full.
Hopefully 3307 is the true beauty of it all and time shows to know best.
>>18828813
Okay so go here
http://rsatools.wforums.net/#encrypt
And use 61 as all numbers and you get the public key 3721 for N. You can pretty much figure this all out with just that, my computer isn't strong enough to attempt what I want to do with the numbers so you guys should all go at it.
000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001000000000001
That should be the binary proof for infinity?
>>18828889
Almost quads, good thing triple 8s are my lucky number any way. Hope this is some interesting shit.
>>18828817
How did you decipher it into Infinity?
>>18828889
Not sure I'm following you :(
>>18828889
I've got a gtx 970
I4790k
32 gigs ram
If you think that's enough power just tell me what to do
>>18828605
Don't get worked up, friend, and don't let those guys insult you. You're doing a great job. I'm this guy >>18828452 and I was simply worried about you there for a sec because the stuff you connected there sounded pretty wild and a bit incoherent, but you seem fine.
Thanks for sharing and actually contributing to the work and this thread.
>>18828889
>>18828605
Btw I suggest you try joining this discord group, since you seem to know what you are doing.
https://discord.gg/btk3nn3
There seem to be more, but this one should be able to help you for now or know of other groups that are working on this.
>>18828889
And also, have you heard of the other rounds/stuff they put out?
There's a whole small book coded in runes they gave out last year, which isn't decoded yet to a great part. Maybe this might be interesting for you as well. Search Cicada Liber Primus
>>18828889
Did a test encryption, but for some reason trying to decrypt it with the same N and e gives back garbage... It would only work if the 2 primes are not equal
Looks like we can relate the initial message of:
"A Fludd approaches.
Chart the stars.A Chord of would WARMS My I"
To a cord of wood, which would warm something:
The dimensions of a cord of wood will basically be 4′ x 4′ x 8′. But sometimes you’ll find some guy selling cords of wood with different dimensions. There won’t be much of a problem with this as long as the volume of the said dimensions will add up to 128 cubic feet.
>>18802180
kek
https://www.youtube.com/watch?v=VesUH54hrxM
everywhere
>>18829320
Chart the rats. A chord of would SWARMS my I.
A swarm might be headed to us?
A flood? A brood?
Look within. Embrace enlightenment.
If we consider `I` from the `WARMS My I` to be Iodine, it's atomic number is 53 which is a prime, not a lead, but just putting it out there :)
>>18829348
Fludd was a reference to Robert Fludd
maybe its 38300
>>18829320
>>18829348
Not sure where that info comes from.
A chord of wood warms my eye (I).
Pretty little phrase there. Say who is Cicada exactly and how does any one know he doesn't want to be found?
They found the spear. Site has been updated
>>18829369
Definitely not a "he" but a group of people. If they wouldn't want to be found, they wouldn't engage with any of us.
>>18829357
oh wow thats spooky. i felt it
>>18829381
What if the spear is a symbol? Have you seen donnie darko? What if everyone has one?
>>18829396
I also believe it to be a symbol, even if a physical object is found, it is supposed to be shared with all, as was stated.
>>18829381
What if they had to engage with us even if they didn't want to, and were trying the whole time but it was so hard and we stopped listening so now every thing is hellish? Just some food for thought
>>18829411
Not sure I'm following your train of thought. But it does seem like they're on a schedule and the last files were of an educational purpose
>>18829396
https://m.youtube.com/watch?v=3ijw729_d8M
>>18829411
Underrated. When you talk or even think IT is quiet. But when the mind is empty IT seems to be raining.
>>18829431
So? Like i said it's all about symbolism to me. A meme...
>>18829442
i think there is a bit of a gap between symbolism and a meme :D But relatively speaking, yes
>>18829446
Maybe we should look deeper into Fludd...
>>18829455
Hermeticism and Kabbala
ACACCGCAGCCCTCCACACCCAGCTCTCTAGCACATC
>>18829455
Definitely; John Dee too, in fact everything that can fill us with knowledge, not for the sake of the puzzle but of our own will. I couldn't agree more that evolution is now a matter of will.
>>18829455
An angel with baphomets legs and wings and a sandclock on the head pulling the human macro and microcosmos... what could that mean?
>>18829465
After conversion to binary, this produced nothing:
00110011111011001011111101111100110011111100101101110111010010110011000111
>>18829467
https://www.youtube.com/watch?v=ySi5hqcCYjA
Y, dunno where to go from there
>>18829469
There's also a cord wrapped around the circle, may be that's the cord referenced by cicada
>>18829467
https://www.youtube.com/watch?v=kTWlzBlMU1g
>>18829480
>overcrookd
@Cicada
charthestarsACssaartAharhCCGchtchCasrAatrrsGCsCaCThCtaCAhrah
+
cCaACctCcarsaraCAaraGtCcaTCahcsTarhCrTcAcGhrssaCssrAhaCcAThC
>>18829489
Good point. This is hot stuff i think
>>18829488
Y
Why?
Y=CUBE
32617is667.wav
>>18829492
Ah, got it, yes I've tried that damned file for days now :D
>>18829509
ALittleHelp.pdf
For those interested in figuring stuff out feel free to join: https://discord.gg/4Zcrj
fuck, i'm late to the party.
>>18829499
ALA?
ALV?
ALEPH?
ALEV?
ALC?
>>18829489
When the cord is pulled completely the human becomes one with the macrocosmos? Intresting to say the least
>>18829512
Yep, tried it that way too, have you had any luck?
>>18829516
The way he holds his hand is also interesting
>>18829516
Is it possible to figure out from the image, something has to happen, good or bad, who knows?
>>18829455
Also in relation to the image and "warms my I". The symbol on the angel's head is similar to this and is translated to I
https://upload.wikimedia.org/wikipedia/commons/6/61/Enochian_alphabet.png
>>18829525
what's with pdf
why explain, why normal language, why Z?
>>18829525
Noticed that too.
I guess one can only answer that for oneself. I recently read something like "The perfect way to mental illness is to try to avoid suffering." if thats what you mean? To be or not to be huh?
Skeletons never look sad.
>>18829422
>>18829432
Glad you found it underrated.
https://en.wikipedia.org/wiki/Rosicrucianism
>>18829582
Nice find. Of course Fludd was a rosicrucian too.
>>18829582
>>18829591
Indeed they were pointing to them for a few years now
>>18829582
And we're all running around with earplugs 24/7... Would explain a lot.
kek
>>18829577
Good one. I def think that the whole occult, mystic, etc stuff is there to shake us up and a sort of filter of those who would be interested.
>>18829595
It is said it was rosicrucians who built reality. What if 3301 wants us to go down that path? I mean they say it all the time... to look WITHIN. Not without. Change yourself and you change the universe. Magic?
>>18829369
Initial Cicada were/are a global group of people; humanists as far as I can tell; pretty much all about encryption and crypto. Had people supposedly work on crypto tools and encryption in anonymous groups after the first hunt.
Most intricate puzzles on the web imho; artworks.
Notice п7п7 at the top :)
>>18829609
It is a very deep question and not only in a philosophical way. I truly believe that it each builds his own reality, if he is has at least a minimum amount of understanding, and if you are a follower, than you are leaving in someone else's reality.
>>18829607
Epiphany seeks the devoted i guess. At first the truth may scare you but then it will set you free?
>>18829614
The bigger picture says something else imho
>>18829602
Higher spirit(?)s trying to communicate (communion) but we don't listen maybe...
>>18829624
There is a saying that whatever you seek is seeking you
I would say http://sevens.exposed/ is a hoax
>>18829623
You're into something.
>Follower fall lower?
Anyone ever notice the iconic cicada picture looks like a mask?
>>18829633
You seem to seek the 33. Good luck my friend i'll be with you
>>18829647
"We want the best not the followers"
>>18829647
If you live in your own reality of your own making, you only follow a base set of rules those which are universal and one for all, you are free to create the rest. But if you inhibit a foreign reality/projection you do not have that privilege, your only way is to break out of it.
>>18829671
To break a prisoncube and build a prism?
https://www.youtube.com/watch?v=iTQXiLlECoY
This is really intresting stuff my friend...
>>18829649
Thank you!
>>18829687
This is an all-around masterpiece. story, idea, lightning, acting, post-production, color-grading, camera-work wise. Love it!
>>18829591
>>18829595
>>18829602
Now you see. Guess what my first name is
>>18829695
100% agree. Everyone interested in the topic should watch it. Masterpiece
>>18829701
Especially considering their budget and the circumstances :)
>>18829695
Beautiful right?
>>18829698
What's the point of "guessing" or speculating if it doesn't bring us any closer?
>>18829698
Why should that matter
>>18829712
Glorious 90's movies yeah
http://sevens.exposed/ALittleHelp.pdf
Found this in the page source.
>>18829748
>http://sevens.exposed/ALittleHelp.pdf
Thanks
>>18823999
If there's a spear in the constellation, where would it be pointing at, based on this star chart? My eyes are way to tired.
>>18829718
>>18829721
How much do you believe and want to hear? Its a wild story I think but it would make all the difference
Also found this the source, there is a wav that is just a text file.
http://sevens.exposed/AMessage.zip
>>18829768
Show me what you got friend. I like wild stories
>>18829768
Wild stories are the best
>>18829772
I think Z, the true cicada flying to the flame, was me in some form at the end of a long hard studious life or two and is releasing this information maybe at 61 and it tandem resonates with me when it exists as I am it and so the releasing of information along with my understanding of it and posting it back to the internet is forming a technological singularity perpetuated by just me, the fire, the third and final cycle of all of this. The entire thing is so smart and powerful it was basically the ultimate spell perfectly cast. It is utterly absurd and of epic proportion but we all glimpse the magic in front of us now. Probably how Split 2 ends, Unbreakable Bruce Willis and the Beast with all his power reunite as one, the ultimate personality. Wouldn't that be a twist, the two timelines become the true one, and who knows what happens then.
>>18829624
>The bigger picture says something else imho
You're projecting then.
>>18829833
Not him, but you should go see a doctor
>>18829855
Yeah I know don't worry I have it scheduled.
>>18829855
https://en.wikipedia.org/wiki/Rosicrucianism
Anyone want to confirm there's now a new signed onion address in the Dropbox folder with both libers?
Just saw one posted but on mobile now
>>18828889
Btw, anyone can shed some light on where we got the 61 and 3721 from?
61 is AIN, the qabalistic nothing. three levels, but they have separate names.
>>18830592
Thanks, this is the meaning of the number, how would someone arrive to using it in an RSA decryption
Further possible thoughts on "WARMS my I"
John Dee believed that that with the help of the inner eye one could talk to the angels (relation to stars). Also "I" could mean the soul, the inner self. Let me know if anyone thinks the initial message needs any deciphering or all of the clues were already taken out of it.
>>18830465
It was from a code that was posted in the last thread that I used and found through the calculate prime tab. I could probably replicate it if I had the initial code I used from the last thread.
>>18828605
Hello we talked before love you Adam from your other half I'll be around
>>18831677
>>18831677
Please make your self more apparent to me! And my name isn't Adam!!
>>18831722
I can't still recovering my dear you already see sea fee me I'm just a girl with many names and they think its better this way keep up the good work I must rest your on the right path
IOU aeiou
I owe you my love
>>18831722
But yes I'm online again I'll be in the sky if you feel low look above as is below xxx
>>18831732
Lilith or Eve?
>>18831732
Your words are so comforting, thank you.
Like controlla, controlla. And I'm never gonna waste thing shorty I do it how you say you want it them girls they just want to take my money they don't want you to have nothing they don't wanna see my find your loving they don't wanna see me, smiling back when they pray
>>18831741
Both u faggot call me eve from now on night xxx
>>18831739
I should have given you better words.
The guilty undertaker sighs, the lonesome organ grinder cries, the silver saxophones say I should, refuse you
The cracked bells and washed out horns, blow in my face with scorn but its, not that way I wasn't born to lose you
I want you, I want you, so bad. Honey I want you
>>18831753
Dylan cried somewhere...
>>18831762
I'm walking through, the summer nights. Jukebox, playing low. Yesterday every thing, was going too fast, today, its moving to slow. I got no place left to turn, I got nothin left, to burn.
Don't know if I saw ya, if I would kiss you or kill you, probably wouldn't matter, to you any how. You left me standing, in the doorway crying, I got nothing to go back to now.
>>18831762
The light in this place, is so bad. Making me sick, in the head. All the laughter, its just making me sad, the stars have, turned cherry red.
>>18831753
Don't make me cry again silver linings playbook got me out of the bad place I read it 55times and I keep it beside me at all times sigh my love we will be to get her soon just not soon enough xxx
>>18831762
>>18831773
>>18831777
Yay kick out the robots plz I want to say I was in a psych ward I quit soda weed I'm eating again I only have this tablet and our secret from here to eternity
>>18831845
We wil meet at Xmas at least once for it must come true I think about it everyday
>>18831427
https://www.youtube.com/watch?v=ql-u7FKhlvY
What else do you think the "WARMS" could stand for?
>>18829623
https://www.youtube.com/watch?v=FFWDEYK_7Wo
These threads have strayed in better and better directions lately...
..and as always, some music:
https://www.youtube.com/watch?v=2eRTQnSzoUI
>>18831773
You seem very sentimental person/-s.
https://www.youtube.com/watch?v=qoOa7kWF1D0
This thread is rife with mental illness. /x/ has become the crazy board.
>>18829833
The funniest part of all of this is that I have both memory of saying this, and none at all. I can't pinpoint when I said this, leading me to believe I haven't.
But I know I have.
I know you listen.
It frightens me. It's exciting.
All I can do is wait now though. I've issued a challenge. And I wait to either win or lose.
>>18831832
>>18831845
This might make you feel some way
Glow worms show the path we have to tread
Dreams as we should be asleep in bed
Moving slowly through the springtime air
Holding moments in the depth of care
Whisper fairy stories till they're real
Wonder how the night can make us feel
Loving living more with love to stay
Long past sadness that was in our way
Dawn time mist begins reflecting light
Waking sun will soon forget our night
Love me through the day and I'll with you go
Into summer and the next year's snow
https://www.youtube.com/watch?v=53t1quQo7jQ
>>18831889
Better little crazy than nothing.
The random craziness makes a good filling for the threads anyways..
>>18831892
https://www.youtube.com/watch?v=Mizo55muY2I
>>18831892
Thats the best way to act. Frightening but exciting. Just be brave and be yourself and love the life your living no matter what. I'm in the same "waiting" line as you friend.
https://www.youtube.com/watch?v=JjjYvMbWeLs
>>18831898
I love this
True
Yes!!!
I ain't Obama
Or m I a
Just yours xxx
I did some more research on Fludd, found his Celestial monochord, perhaps someone with better math/crypto skills could make any sense of it. I'm thinking it could be related to the .fastq file.
>>18831901
May I ask you, was this your thought, or mine.
These words are too familiar to me.
>>18831930
100 percent mine? I just typed them out.
>>18831928
The most interesting part is the mysterious hand and finger holding the thing up for me.
Any way to relate the initial star chart to this big globe?
>>18831938
Sorry. I'm too questionable.
>>18831938
I don't think this relates to the star chart directly, but to the fastq file, which has the @Cicada string full of characters that don't belong there, based on file specification. I just don't what the musical notes relate to
What the fuck are some of you talking about?
>>18831951
Interesting, not sure how to reply to that.
What evidence could make a guess be accurate? Recognizable at the craftsmanship of the amulet with the jade piece? A rare yet familiar cut, with a custom design link, you think I feel the love?
>>18829338
I can't believe they made it.
It was beutiful to watch with my own eyes. The meaning behind it is lost though, I remember it all.
Thank you to whoever made that. It was amazing. I'm cried.
I've found the monochord v2.0 from Fludd. This one doesn't have the characters from the 1st version. Trying to figure it out any help is more than welcome
My bad, the monochord seems to miss the `s` that is found i the fastq file :(
>>18832007
Looks like an equal and opposite reflection of what is essentially the same thing. It looks like a chart to enlightenment basically, up the 10 segments away from the sun in the middle and you get your own knowledge of the sun and go back to the start of it all basically. Those are just the concepts as I see them though.
>>18828605
Have you ever laughed at your own joke?
I remember I made one the other day. I dot know how to piece it, but I'm sure someone will. I'm sure it will make someone laugh. Hopefully someone remembers how it really went. All I remember is that it had to do with government, remote viewing, and punching balls.
>>18818758
Yes, it is a copy. A complete, unaltered copy.
>>18810894
That is the point, yes.
>>18829614
Maybe it's a method to train people, so they can decode their surroundings. There must be so much encrypted works out there that are ancient, just nobody has realised it yet.
>>18832071
I'm definitely having fun, learning new things and picking up sciences I wouldn't care about otherwise. I do not care for epiphany or enlightenment, I believe those can not be taught or brought to a person (even by guiding him). These are the rewards of your own path and actions not of someone's guide. Neither am I interested in joining any secret societies or hacker-clubs :D
Mandela Effect - Discord group
https://discord.gg/wBjAD3j
Come in chat about Mandela effect.
Kek
>>18832877
"Give every man thy ear, but few thy voice."
>>18833124
"There is nothing either good or bad, but thinking makes it so."
>>18832063
we wonder why you name yourself thus
this one has something hidden in the dark but I cant make it out
>>18834155
From CHAOS comes creation
https://en.wikipedia.org/wiki/CHAOS_(operating_system)#What_it_is
fake and gay
>>18834155
Could you let us know where this came from please?
>>18834873
link off YouTube video, She pulled it after a few minutes https://www.youtube.com/channel/UC4htb2Lmt0nxlc0xO0qh3yQ
>>18834997
I have it in my drop box https://www.dropbox.com/s/gknf5sfdkmmxuvn/drtdryftuy.bmp?dl=0
>>18802240
>>18804957
inb4 it's telling us where the next HWNDU flag is gonna be
The 7 Watches
The Hand
The Seraphim
Unfold Wings
>>18817030
3301?????
>>18818758
It is a copy.....where the fuck is OP?
>>18834293
I can make out numbers, right side looks like it's writing for the blind.
So is this another Cicada 3301 hunt?
>>18834293
>>18835219
the problems (beyond the obvious):
0 and 8 are very similar
0s are sometimes drawn with a strikethrough so any apparent 8s might be 0s
we don't have a clear 9 to know what those look like
we don't know for certain they are all numbers.
what i have done:
where it is unclear, i have listed all possible digits with / between them listed from most to least likely by my reckoning.
where there is a single dot, i have left a ?. i suspect these may be dashes
i have assumed that 0s are not struck through
i have assumed that digits to not overlap
i have assumed that the same digit always uses the same symbol before randomized pixel deletion
i have assumed these are all numbers
first line:
5 1/4 ?? 2 3/5 7 ?? 3/5/6/2 1/8/0 ??? 8/9/0 2 5/9/8 2/8 ? 6 3/5/6/8 2/3/0/8 2 2 8 ? 9/8/0 2 7
third line:
1/4 7 3/5/2 2 0/8 ? 5/6 4 2 2 1/4 8 2 6 1/4 0/8 ? 9/8/0 2 5/3/2/8/9 5 1/4
not the most useful i know, but it is a starting point.
the other lines are not the same. possibly letters?
>>18834293
Left side might be braille-writing, but I can't make anything out of it..
I just like to see people work on this. It's interesting...
Should we start celebrating 3/30/17 Day, every hundred years? :D
I have another dozen or more photos so that don't seam to be circulating but they aren't very good quality cuz I just did a quick capture with screenshot
>>18835734
7 wings
>>18835749
>>18835751
>>18835762
>>18835219
>>18835478
>>18835488
Yes guys, for the first time I get the meaning of a certain saying and I can unironically spell it out: That's the spirit!
>>18835765
>>18835773
>>18835749
Where is this from?
Where are all of these from? But the one I quoted in particular.
>>18835778
>>18835704
Holy shit I didn't even realize that.
3/30/17
3301 and 3307. Beautiful. Love you Anon.
>>18835783
one of their g mail accounts that I stumbled on, bet don't think that would be far to give that out
>>18835785
>>18835795
>>18835803
Now it's really getting started in here. Everyone should take a look at this right here too.
>>18830433
https://www.youtube.com/watch?v=0JJz36rSob0
keep in mind I believe those pics where taken down because that part of the puzzle is closed, so just the Wing photo and another 1 I choose to hold onto have any playable meaning, but I will say the other photo says something about forum 9 and has a quote
The 7 Watches
The Hand
The Seraphim
Unfold Wings
>>18835783
all so the name of the wing photo was Alatus print II here's my drop box of it https://www.dropbox.com/home?preview=Alatus+print+II.png
>>18835772
"spirit" s-p-i-r-i-t. Spear-it
Spiritual Spear-ritual Spear-it-u-all
>spear it guys!
Spear = Tool/pen
Spear it = work, do it, write it, code it, crypt it
>I'm becoming as crazy as the IOU-guy
>>18835985
I LOVE YOU!!
7/7/7 AEIOU.
Delusion is de illusion.
Insanity is in sanity.
YOU'RE IN THE ONLY ONE TIMELINE NOW!
>>18835989
Another fun fact:
German: Fuel = Sprit
What do you need to drive a car? That's right sprit.
>>18836008
YOu could also run a car on spirits (english) but not for long :D
>>18835931
Wrong link :)
sorry guys I am tired and have been up for days working on this puzzle here is a proper link https://www.dropbox.com/s/1fpy9fbb5q1zq0r/Alatus%20print%20II.png?dl=0
>>18836020
I run on spirytus ;D
>>18835989
Good thing.
>>18835989
They call me crazy.
Nah, I'm just "le intelligent but lazy".
-"why can't you be n act sane?!"
-Cuz it's a zero-sum game.
I believe we can draw a relation of the phrase "Lions guard the lion" to Saint Jerome. I believe the hint was in the AvantGarde image from sevens.exposed which was on the back of the Saint Jerome painting
Also this could mean the LION cipher: https://en.wikipedia.org/wiki/BEAR_and_LION_ciphers
I forgot to post these one's as well, just have to much decoded files and things everywhere its hard to keep track begin sleep deprived , kind of interesting this one has some code called brainloller in it that's brainfuck in pic form
>>18836216
>>18836221
>>18836226
>>18836228
>>18836230
>>18836237
>>18836241
And the deleted file was called Voltaire Candide
>>18836121
>Saint Jerome
Jerome wrote didymus the blinds stuff up
>didymus invented braille writing
>>18835488
Better try once more..>>18834293
>>18835985
You can take it apart even further.
>spirit
>s pi r it
>s=sine=time
>pi=TT
>r=?
>it=IT=TT
Twin tau anyone?
Fun fact:
Four = Vier (pronounced fear) in german
Vier= Fear
Kill the fear the six repents.
What is six? Six-to-one? Setone? Satan? Saturn?
Hostone we have a problem here. Mayday. Mayday.
Code:Red
Code:Read
anybody can help figure out the LION cipher to a dummy (me). Might be used in the `fastq` file
>>18836300
I found these sites helpful to get through most of the pictures, but I am still a green, https://esolangs.org/wiki/Hello_world_program_in_esoteric_languages
http://www.dcode.fr/tools-list#informatics
>>18836228
What are those "sticks whit branches called"
Looks like the one in pic
>chart the stars
>>18836300
Here's an implementation of the LION cipher in C++ perhaps someone could check this?
https://pastebin.com/JYMCTs8E
>>18836371
http://quod.lib.umich.edu/cgi/t/text/text-idx?c=eebo;idno=A51768.0001.001
Dunno, where am getting with this really.. Trial n error?
>>18836294
if you want to deconstruct it into math terms:
pi you know
r is typically radius or position vector
i is imaginary (square root of -1)
t is time
if you take the sin of these combined terms, you get nothing useful as far as i can tell.
it should be noted that sin(n) decomposes into:
(e^(in)-e^(-in))/(1i)
in case anyone feels this rabbithole is worth chasing.
So what's the conclusion of it all
>>18836268
Damn, I guess I mixed up two different puzzles..
Or did I?
Better go to sleep I guess..
>>18836488
Thanks thats awesome.
Spirit
S coming from TT going into imaginary time.
Mind=Blown
A possible solution to "WARMS my I"
If calculated with the masonic gematria:
WARMS = 1101 = 13 (prime)
I = 9
more speculation: 13 + 9 = 22 (mentioned in the PDF and website as encryption key)
gematria used: http://www.masoncode.com/Masonry%20and%20Cabala.htm
>>18837182
Or may be "13" relates to charting the stars and to the sign of Ophiuchus?
Ophiuchus can be related to the phrase: "The Lions roar, as serpent calls."
The brightest stars in Ophiuchus include α Ophiuchi, called Rasalhague ("head of the serpent charmer"), at magnitude 2.07, and η Ophiuchi, known as Sabik ("the preceding one"), at magnitude 2.43.
The brightest star is classified as A5 III, A5 being the hex value of the 10100101.wav file.
Am I qualified as insane now?!