Has ANYONE gotten better due to these people? has your depression, anxiety gotten better?
has ANY pill worked for anyone that hey prescribed you?
>>134715215
They worked when I took them but fucked me up beyond belief when I stopped taking them and I haven't been normal since. And that's just a year off adderall, the SSRI's are a whole different class of fucked up.
Saw one when I was a child. Immediately put me on meds after a 30minute intro. Didn't help at all. I think they are a scam used to take advantage of weak minded people who can't solve their own problems. Nobody knows you like you do.
>>134715215
>falling for the mental jew meme
>Anon, I think you're on the edge of a real breakthrough
>We'll talk about it at our next session
>That'll be $100 dollars
>>134715215
Prescribed Prozac. It did work for depression + OCD. It also makes your dick numb. Consider your options carefully.
>>134715215
It can be beneficial for some people to have an uninvolved third party to speak with about their problems, but there's no way in hell I'd ever take any (((pills))) they would prescribe. The science just isn't there
>>134715215
Basically legal drug dealers
>>134715215
Psychology is a jo-
>https://www.youtube.com/watch?v=jSo5v5t4OQM
>>134715215
I go to a therapist weekly. Insurance covers it, but I have a cheap copay per visit. I refused all prescriptions recommended to me, so I'm just getting the regular cognitive behavioral therapy.
I sit there, tell my doctor what's on my mind, how I've been feeling, and get told an anecdote along with "have you tried doing X instead?".
It's a waste of time, no advice given to me has lead me in any sort of helpful direction. Funnily enough the lack of help it was providing gave me the motivation to find my own way through my problems. Been feeling better for the last few months, still have my bad days, but I get through them.
>>134715778
why did you stop taking them?
Psychiatrists are evil, avoid at all costs
Psychologists are ok, but it's VERY hard to find a good one who isn't bluepilled af
>>134715215
They want your insurance. Medical in USA is a scam.
>>134715215
ask any psychiatrist these questions.
1.have you ever cured anyone?
2.have you ever sent a person home saying''that is just normal feelings,you're a human you'll have them from time to time"
3.what percentage of your patients are on prescription drugs with possibly lethal side-effects.
4.can you detect ANY psychiatric illness with an autopsy?
psychologists can be good,but anyone who will listen can help you.
neurologists are legit.
psychiatry is the medical community's political wing.
Here's an insider secret idk if I should be sharing.
I use to trip LSD, prolly what drove me insane, had a couple stays at some psych wards.
The 2nd stay I was prescribe an antipsychotic, they said don't do any other drugs with it.
Tried LSD after having took the prescription for a while.
Couldn't trip.
Stopped taking the prescription and I could trip.
Check my ID.
>>134716373
I just felt like taking amphetamines every day was going to end up having more cons than pros in the long run, I may go back on them some day I'm not sure yet but it sucks to have forgotten how I felt without them
>>134716372
how long have you've been seeing him/her? why not quit?
>>134716086
Same
But the money spent can be prohibitive. It's not so bad if you have insurance and just pay a copay. But a lot of therapists just avoid insurance and only accept patients who can pay up front.
I probably wouldn't bother with it if I had to pay 100-150 dollars out of my own pocket every session.
> Lithium really helped me remove constant suicidal thinking. Overnight.
> Antidepressants have never done shit.
> Risperdal - not sure wtf they gave me that for.
Therapy works best when you are actively working on fixing a problem. Helped, alongside rebooting everything in my life and working very hard, got rid of my PTSD.
If you're depressed it os most likely because you are having a normal reaction to the dysfunctional society you are existing in. Modern socierty does many things right, but completely fucks the individual, and many phenotypes end up with "depression" because we are now useless and not able to thrive, nor even navigate. In my experience.
>>134715215
One word: dextroamphetamines.
>>134716702
Ive taken Lexapro for like 5 years. Helped for a couple months, then I ended up feeling numb most of the time.
Tapered off of them now and Im going through hell. Its been a couple months.
>>134716685
Antipsychotics are dopamine antagonist (mostly). LSD is a 5ht2a and dopamine agonist. By blocking the dopamine activity you were unable to trip.
((((((Scientologist Detected))))))
They literally only exist to report people that are deemed problematic to the police. Doctor patient confidentiality isn't a thing.
>>134715215
It's all bullshit. They have no bodily evidence. Say something they dont like they start inventing and removing adjectives that describe the functions everybody else does. Things like anxiety. Cant be anxious. That is a pathology! Anxiety is completely fucken normal and serves a purpose but you envy your father's dick or something
>>134717292
huh?
>>134717197
Good to know it wasn't some magic potion. I don't miss tripping, though.
Every trip I always tried to normalize the experience until sober. Big no no if you want to stay sane.
Telepathy is my current battle at the moment.
>>134715215
Had symptoms of depression, complete lack of motivation to do anything, didn't want to socialize due to social anxiety and sat by myself all the time.
Went to psychologist, was worthless. Effectively spending money to have someone listen to your shit and then proceed to do nothing.
Went to psychiatrist afterwards, talked for like 6 months before he put my on run of the mill antidepressants. Didn't help with anything except my temper tantrums (Got angry and broke things). Nothing else improved so I got put on antipsychotics after he diagnosed me with a psychoaffective disorder (schiofrenia with a mood disorder such as depression, bipolar, etc.). Did absolutely nothing to help my problems, and now I have tardive dyskinesia (muscle movements/twitching on a permanent basis) and tinnitus (ringing in my ears constantly).
Don't fall for the antipsychotic meme, you will regret it.
Eventually I just stopped going to psychiatrist and stopped taking everything except my antidepressant for my mood swings. Found out my whole problem with not wanting to engage with the world was because I always had a feeling that something was severely wrong with it, kinda like how people have a problem with psychopaths because there's something missing with them. After I became a National Socialist, it all became brutally apparent. My life has improved measurably since.
90% of Psychiatry is a ponzi scheme. Don't fall for it.
>>134715215
I have one and yes they work
/pol/ is right about some stuff but therapy is not one of them
They help immensely
>>134717407
>sees flag
>>134715215
a racket for the jews anon
>>134716072
Same
I got Sertraline and I got the numb dick
Takes forever for me to cum but boners arn't a problem
GF loves it though cause I can pump for hours now
>>134717413
Their founder, the eternal cuck, L. Rond Hubbard based much of his work on the belief that all existing mental health services were activactively working against the betterment of the overall human condition. Such as the statement that " Hitler's mania was caused by psychiatric treatments and medications".
>>134717509
Agreed. /pol/ is not always right.
I was feeling like I was gonna kill myself any moment until I went with a psychiatrist. I was extremely shy and I often had panic attacks in public. Now, I finally got the balls to talk to girls and I can go out without feeling like I'm gonna die.
>>134716733
About 6 months now. I have to keep going to appease my family and girlfriend despite me telling them it hasn't done much good for me. They'd rather hear that I'm "in remission with little chance of relapse" from my therapist than from me.
It's odd because my therapist knows I have been forging my own path through my issues, and knows my thoughts and feelings on visiting them, yet still gives unhelpful advice and refuses to revise my patient report in any way, even though I have met some of the goals we outlined when I first started going. I was actually going to ask about why they won't change anything next time I visited.
>>134717594
>sees the other vast majority of people who arent standing for this kikery i wont take your word for it! start taking blood tests or image scans to prove anything you say. Kikes like this
>>134717292
MUH MUH ANTI FAGGOT MEMES. You are why everybody is half a fag. Men and women and always have been. And you put em in boxes and they kill themselves and you invent words like gay and straight to keep them in your womany organised mess. The sign of the covenant literally burns your witchcraft and heresy. Crusader fags are THE WORST
>>134717407
Anxiety and depression serve many useful purposes. They are emotions that can help you id that things are going wrong in you life, and at a primal level make you take action.
But we do not have a society that allows us to address or deal with the systemic anxiety and depression it causes. Nor can we discuss these things, the media lies to you, your parents likely can't help, so medicine offers a good a solution as it can make.
There is bodily evidence that some people have broken or overactive or underactive neurotransmitter receptors, generation, or brain activity. These can be detected - for example with pet scans and mri, or with biopsy after death. There is also evidence that psychiatric drugs due have effects. Many times the side effects are not worth it, or it is totally over prescribed, because medicine cant say "your life sucks because x y and z"
>>134715215
ITT: fedora tipping morons who don't understand the value of mental health because they lack any real mental capacity anyway.
>>134717870
I dont believe any of that. Sorry. All mental illnesses are spiritual problems
>>134717775
In the same boat as you, keep it up bud
Therapy mixed with proper medication can do wonders
>>134715215
>Are psychologists/psychiatrists a joke?
Not a /pol/ thread.
SUSPICIOUSLY sounds like a stealth $cientology thread, however, so their hate boner for the one profession that can break their cult hold on people.
Know this, $cilons....We may share an enemy in the eternal Juden, but you are next on the list once we are done giving Helicopter rides to the leftists.
>>134715215
nope. pills suck. i really encourage you to just be healthier. it can help some people, i just didn't feel any benefit from pharmaceuticals or therapy.
>>134718040
Fuck off
>>134716372
>the lack of help it was providing gave me the motivation to find my own way through my problems.
Holy shit. This is exactly what happened to me during the very brief time I regularly saw someone. I was never actually able to find the words to explain this though
>>134718072
Oh damn, you came out of the woodwork quick.
Lol
Warning /pol/ you are in a stealth $cientology thread.
>>134715778
THis sounds about right Minus the adderall.
>>134717435
Yeah, it's not a magic meme. There is hard science behind it. I think doing any psychedlic in your case is not a good idea, and I am a huge proponent of them. You know yourself pretty well though so that's good.
There are many newer antipsychotic medicines that might help. You most likely have a very active dopamine 2 receptor system inside your brain. There are many evolutionary advantages to this, but sometimes it can cut the other way as you have seen. Examing the exact makeup of your or mine brain, at the chemical level, is currently impossible. If it were we could make some really cool treatments.
If standard CBT doesn't do it for you (it didn't for me, I found my therapists to be too affirming) look into DBT (Dialectical Behavioral Therapy), it's a different approach that forces you to confront mental roadblocks head-on instead of skirting around them. Helped me a lot.
>>134715215
They're just drug peddlers that work for big pharma, like doctors.
>>134717834
What the actual fuck are you on about dick sucker? Go find your man ass safe space somewhere else. Stay on topic faggot, nobody wants to hear you shill for fruits.
>>134717951
Ok.
>>134717775
What meds did they put you on?
>>134715215
Yes and no. The pill they gave me did a great job of numbing me up. "Numb" is an improvement to "miserable." Let me work with a therapist to make and take steps to improve my overall situation.
It was good for the year that I took them. I wouldn't say that they are a magic pill that makes you feel better about your problems, and I wouldn't advocate taking them long-term.
>>134718151
Ugh. Everything is fake and divide and conquery. Mixes the spiritual problems I said. With spiritual problems. For more spiritual problems. And you. And scientologists. And psychiatrists. And the puppets behind them. Are all wrong. Pic related and also the movie "Misery"
>>134715215
ive tried going to a number of them and they are all extremely blue-pilled, every single one has immediately tried to put me on meds.
one before i even divulged anything worth medicating me over.
it was just a get-to-know each other thing.
got up and left as soon as he suggested it.
they are 100% jokes.
if you want real help, help yourself... maybe seek cognitive behavioral therapy.
>>134716685
> Couldn't trip.
What do you mean?
Did you suffer from dissociative disorder Schizophrenia?
The antipsychotic apparently blocked the psychedelic effect, shouldn't it just do that?
>>134718252
CBT is babby's first therapy.
REBT and DBT are god tier.
Keep it up, you really can make a fantastic life with it. REBT helped me reprogram my brain.
>>134717407
Just because therapy wont cure your gay doesn't mean it doesnt work for people with REAL problems
>>134718219
I try to stay away from psychoactive substances now-a-days, don't even smoke pot anymore.
Having been involved in some crazy psychonautic stunts with tech and field I've been offered UX positions that I'm certainly underqualified for.
UX for psychotherapy could be huge with the right education and experience.
>>134718277
Anytime anybody exposes or uncovers your fucking synagogue of satan right wing tactics or lies you just repeat what was already blown out but triple down on the ad homs. You cant tell me im fucked in another thread. Come in here see everybody agreeing with me. On this. And then call me a fag and leave the psychiatry to the other threads. Piece of shit
>>134718330
I guess
>>134715215
I was on Setraline a few years ago for a few days. It worked wonders on my depression. However I started to have hallucinations. Needless to say I stopped.
>>134715215
NAXALT rule applies here
Yes, the guys that actually can help you exist and I hope they don't stop fighting the good fight, but the median are basically drug pushers and friends for hite5
>>134718491
So theyre fake problems and i went to them but didnt and they didnt fix anything but they did or fixed me and fixed nothing about me. K
>>134715215
Honestly I feel like I've gotten better but it's become a 2 steps forward 1.5 steps back thing and I feel like I might be able to go well without the meds but I fear how the long-term withdrawal effects will fuck up my work and schooling.
>>134718635
Yeah, well, you should ideally just be using them to take steps so that you can get off them, and not feel miserable.
>>134718091
Yeah, in a sense their failure (or mine, depending on how you view it) was still a success. I had identified everything that needed to change and started working towards actually changing.
>>134718388
>Ugh. Everything is fake and divide and conquery. Mixes the spiritual problems I said. With spiritual problems. For more spiritual problems. And you. And scientologists. And psychiatrists. And the puppets behind them.
Holy shit mother fucker, learn to construct proper sentences before posting next time.
Took an SSRI and a benzo for 6 years for anxiety/depression/panic. They temporarily helped with anxiety attacks but my life got completely fucked when I came off. They aren't worth it. The mental health problem is nutrition problem in America. Research copper toxicity and what other toxic metals can do to a persons mental faculties. The drugs are mostly garbage that allow you to not face your problems.
>>134718630
Well he probably said wanting to snip off your peepee is concerning and you got offended
sorry sweetie
>>134715215
psychiatrists are like cleaning out a wound. You gotta get out the dirt. It's gonna sting, but it will heal better in the long run.
>>134718510
Me neither, I can't smoke pot without hallucinating. The last time I did I felt my psyche literally break and have no desire to do it again.
That's cool about the jobs. Many old school tech companies were founded on LSD inspired ideas. This is what I was sayingabout dopamine cutting both ways - it can make you halluciante, or be super creative. Take the UX jobs my man, tech needs redpilled people more than ever!!
>>134715215
Psychiatrists = drugs. Can be useful in some cases, but generally nowadays it's all insane. Psychologists can be helpful but it's hard to find a good one. Most are shit and have serious issues themselves. You need somebody smarter than you with a lot of life experience to basically be your mentor. This is what really helps. Particular psychological methods vary in effectiveness depending on the type of problem and your personality. A good therapist will make any method work if he knows it well, but some are more suited for some cases.
>>134718744
Nice literary critique but youre a spineless bucket of gelatin and a goof eh
>>134718477
what does REBT stand for?
>>134718801
No you just let a woman hold your balls in her original sinning coin purse of an estrogen hole
>>134718826
>>134718630
>eh
Can't tell if Gay lead, ESL leaf, or $cientologist ESL Leaf.
>>134715215
>Has ANYONE gotten better due to these people?
no
>why do they get paid if they dont help any one
it makes normies feel safe
>that doesnt sound right
and how does that make you feel
>sad
im going to prescribe some pills. low level anti depressants and a sample bottle of a sleep aid on the house
>k
>>134718812
duly noted.
>>134718477
Kind of funny since DBT was created by a woman for women suffering from borderline personality disorder
God Bless Marsha Linehan
>>134718934
Wow sweet. Nice discussion on fake psychiatry we're having
>>134718892
There were so many buzzwords in that sentence it made my cis head spin
Anyone else here been on fluoxetine or olanzapine?
I was put on both at the same time and I turned into a very violent, manipulative person. Has anyone else had similar experiences?
>>134718832
Rational emotive behavior therapy
It was like the alpha version of CBT.
DBT is so good also because of the mindfulness component, which is about the only place medicine will bring any spiritual concept into play.
>>134718892
>No you just let a woman hold your balls in her original sinning coin purse of an estrogen hole
So much purple prose to say so little.
>>134715215
Has anyone gotten smarter listening to retards on /pol/?
Maybe try neurofeedback therapy. It treats your brain like a muscle and it tracks when you hit certain levels and rewards you; it retrains your brain.
>>134718733
Been on them for 2 years my dude and at 200mg (2nd lowest dosage I can physically be on)
>>134719013
>generic meme memes
Wew laddies. 1+1= meme frog. Everything is either gay or a meme frog. The simplest of statements. WOW LOOK I DONT UNDERSTAND OR THESE ARE NOT GOOD ENOUGH OF WORDS BUT I CAN MOCK EM GOOD
>>134718957
Roflmao
>>134715778
Just keep the scripts and sell the adderall. At least profit from your illness.
>>134718635
I took SSRI's for 5-6 yrs. Coming off of them is shitty. Your brain is used to the pills providing serotonin. Once you stop its.... not fun
>>134715215
One pill I used to take did help me a little. That was until I stopped taking it and I was unable to eat or sleep properly for months. I still need a few drinks each night just to get to sleep. It really isn't worth it. Improving my diet, exercising more and religion have helped me far more than any pills ever did.
Not a pill. maoi patch. Emsam. Selegiline hydrochloride delivered transdermally.
Helped massively with depression and motivation.
>>134715215
dont be a kek, it's all in yer head. dont buy the pharmagarchy's lies
Not sure if it's related, but my exes girlfriend had Electro-Shock therapy to deal with her depression.
Her memory is now shit and slowly coming back, but it did cure her depression. She's not cutting herself anymore, and she's also moving ahead with her career.
>>134718996
That is funny. I have many issues with personality disorder labeling, but they are real, and BPD can actually function and become human after DBT (as long as they have empathy). If it can help such an extreme case it can help many people. I am very glad you were able to help yourself with it.
>>134719079
Yeah the fall of man was fuck all. I dont like how you debate or type either. Go tell the bus driver your sopranos lady all about how your mom was mean to you once or some shit
>>134719138
I'd be working on wrapping that shit up soon. Nothing wrong with a good dose of numbness to let you fix what you need to fix, but its not something to become used to.
>>134715215
Psychology itself is not evil. That said, you're generally far better off talking out your problems with someone who is successful in life - if you can find such a person who will discuss such things. Most issues in people's lives can be solved by some rational discussion.
That said, if you had some significant childhood issues, I might look into something that is called "parts therapy". The truth of the matter is that we have multiple "parts" to our being, that surface from our subconscious to our conscious at certain points in time, dependent upon the circumstances. These parts, while not usually complete individuals, can present themselves as such, and are - probably to the disbelief of most people - able to be communicated with independently. A person can, given enough time, work out the problems with these sub-personalities on their own, and even unlock hidden potential that these are hiding. Specially trained psychologists can help with this.
The solution is almost never chemical - though the current field of medicine has been corrupted, and therefore deals almost entirely for the pharma industry.
>>134715215
I worked at a mine in middlewestern canada
these people make 200k but are very depressed and drunk all the time because of nothing to do + family away + hard work
I did sessions with them, getting them over stuff and etc
>>134715215
psychologists/psychiatrists are a bunch of egotistical faggot jews that push pills and dont give a fuck so long as they are payed, i hate even hearing about them
>>134719022
That is strange. Olanzapine I have used very briefly, it is used when you are actively suicidal, it will stop you.
The fluoxetine was likely the culprit. It isn't a horrible drug, but I think in some rare cases like yours is unleashes an inner violence. I would say any SSRI is abad idea for you. Zoloft made me very angry.
>>134715215
Yes. I had severe anger issues, and was tired of taking meds. Talked to a guy, he helped me realize to self improve and become a better person.
>>134717951
http://www.nature.com/mp/journal/v21/n6/full/mp201569a.html
Spiritual yes but also affecting the physical. Abuse damages the soul.
>>134719246
Yeah they put me on 800mg (highest dosage they can put you on) and neglected to tell me that
>Short term memory will be non-existent
>Struggle to do even minor mathematics or linguistics on paper
>Withdrawal effects from dropping a dosage is fucking horrible and makes it twice as bad for nearly 10 days
>>134719236
>Go tell the bus driver your sopranos lady all about how your mom was mean to you once or some shit
Psychology and Psychiatric help have their uses.
They are like a hammer. They can either build a mind back up, or destroy one. It depends on how it's used.
I am not sure what else you want to discuss. You entire thread concept is essentially akin to asking "Is biological science bullshit" or "is the theory of gravity evil"?
You are trying to assign negative connotations to a realm of scientific/medical research like some sort of religious nutter.
>>134718817
Plus a lot depends on you. If you have a clearly defined problem and you are motivated to make a change there is a good chance of something positive happening. Otherwise you end up with a very expensive "friend" to talk to. Good therapist should tell you to fuck off, bad ones keep leeching you. Run.
>>134719475
Better than cold turkey. I was on some pill, can't remember the name. They took me off cold turkey, since it was low-dose, because I became manic. That REALLY sucked. They put me back on, cutting the low dose in half, and then slowly starting me on Welbutrin. Did much better on it.
>>134719194
Selegiline is very interesting. That is very cool it helped!
>>134719229
Electro shock is rough but when it works it is a nuclear level reboot. The only drug I can think of it like it is ibogaine. Her memory will be effected for a while. I hope she doesn't have to do it again, the side effects seem to accumulate. I wish her the best.
>>134719464
If spiritual problems mean the soul is hurting body why do you say the body hurts the soul? I dont feel like clicking on your link but even if by a lie and stretch it says psychiatry has evidence that the spirit is causing physical damage. Then that's not a place for a psychiatrist to judge. Because they can't say that. No man can interpret God's natural laws. Ok i clicked it after all. The following was first sentence
>The pattern of structural brain alterations associated with major depressive disorder (MDD) remains unresolved
K. You sound like you have those body part measuring pincer things in your hands
>>134715215
lifelong war with depression here. Went to a psych for a few months, found it pointless, was given drugs which didn't do jack shit, except give me vertigo if I missed a dose.
That said the best advice I ever got, and what turned around my war with depression did come from a psych doc. The doc told me straight up "you'll always have this problem, so you need to learn how to live with it." She was right. Once I accepted this will always be part of me I was able to find ways to cope without meds. Tricks to break me out of self destructive spirals, and ways to live a good life anyway. Sure, I still don't want to get up some days, other days I wish I was dead. Sometimes I don't want to talk to anyone or do anything. Sometimes this happens for months on end. But I still get up, I still go to work. I still talk to people and act like I'm normal.
As a result thanks to that doc, I've now held down a job for 4 years (after never holding one for more than 6mo) I have money, a wife, a baby. In general my life completely turned around. Yes I still have crippling depression. No I never found a medication that would help. No I never found going to a psych doc help in the slightest. But YES that one bit of advice from one psych doc saved my life, turned it around and made me "mostly" content with my life, even if I don't feel good most of the time.
just fucking man up and find a way to deal with it. don't use it as an excuse for failing.
>>134719476
The earth is not a pear
>>134715215
Yeah it's worked for me so far. I saw the GP after I realised I have trouble talking to people and it had brought me to my wits end. She initially diagnosed me with depression and possibly Aspergers. She prescribed me on Nefalexin and it's helped me out. Still waiting to see the doc at the Mental Health unit to assess further if I have Aspergers.
I actually have Autism, lads.
Use psychiatrists to get extensions on assignments in school. If you are having legit problems, try Neurofeedback (the only psychology-related thing that's ever actually helped me).
If you have a personality disorder or schizophrenia, you're fucked because they have no treatment that doesn't make you retarded. In this case psychology really has failed you.
>>134719751
I know this thread is conspiracy level edgy nonsense, but actual good psychiatrists and psychologists are well aware of issues with the professions. Good ones should tell patients that exercise is equivalent to an SSRI and that therapy is actually based for mild depression, anxiety, etc. Evidence suggests this as well as temporary, not permanent, antidepressant treatments unless people keep going off of them and getting bad again.
Psychiatrists specialize in treating people who objectively have serious health issues like severe bipolar and schizophrenia. These are not the people in this thread unless I'm mistaken. In case you all didn't know these are actual medical conditions. You can see examples and actually educate yourself on them. These people are really, really sick.
Basically, most of you are idiots. You don't know shit about pharmaceutical companies, doctors, or anything else except your second hand anecdotes. I was skeptical about these professions too until I saw a lot of it.
>>134719826
You know what helps? Infrared light. From a device. Right on the forehead. I just saved you 60K
>>134719702
My therapist told me the same thing. Once I accepted that I can easily fall into a mental shit heap, I was able to focus on loving myself even if it happened, and having a life. You might want to check out REBT or DBT. I am happy you have . job and baby :) That really is fantastic.
>>134715215
>seeing a (((psychiatrist)))
>taking pills for mental "illness"
anymore jewpills you take regularly? is BLACKED your porn of choice?
>>134719913
>I know this thread is conspiracy level edgy nonsense
Not only that, it's possibly $cinetologist infiltration of the board. I have a theory they didn't leave after 2006.
Remember Joy Villa? She's a huge shill for the cult. They're attempting to ride the Trump train to make cash off unwitting Trump supporters.
After she wore this dress, her single sold like crazy. (she then donated a ton of the funds to the cult).
>>134719428
Huh. I wasn't suicidal when they put me on them.
I've been on Zoloft and some other drug before that but I never had any bad effects from those while I was taking them.
I was in a psych ward at the time so maybe I was just going stir crazy.
I've gone cold turkey off every drug I've been put on but I never seem to get the withdrawal either.
>>134719826
This
For minor problems, seriously minor problems.
Psychologist and therapist can be useful.
If you're actually sick, there is little to nothing that can help.
The human mind is too diverse from person to person and our subjective reality of what is normal is near impossible to baseline with medication.
You know what makes you feel happy, some doctor can not.
Every once in awhile you'll come across a person on that right medication and right dosage.
They genuinely feel better.
This is a very rare event for those who are sick mentally.
>t.I'veneverbeenhappyinmyentireliftandhavenoideawhathappinessis
I'm almost certain I have schizophrenia on some scale. My paranoia is extreme.
Let me tell you about psychologists and psychiatrists, as someone who just got a degree in neuroscience and had to deal with these people for 6 years.
First, I have respect for the mission. Plenty of people have struggles. The destruction of the United States' social order has left people in such a terrible state of malaise that I think they have a very valid mission. Lots of people have no idea where they should be, feel no particular calling, and are dissatisfied with life. These people seek to help them, and that's just great.
BUT....
1- Psychiatrists are in such demand that they often see patients only some half-hour every so often. I've known some who have private clinics; I cannot describe how packed their schedules often are. Paradoxically, because they are in such demand, they are paid huge salaries, which permits them to take off time basically whenever they feel like it. Often they will kick the can down to the Psychologists and counselors beneath them; the psychologist/counsilor makes a rough diagnosis, then the Psychiatrist does the actual prescription writing to confirm after a brief meeting. It's not particularly warm or super accurate, but it processes as many people as humanely possible through the machine.
2- These people suffer fatigue from the job. Most of what they do? depression and substance abuse disorders, as well as crippling personality disorders (such as Borderline Personality Disorder) that is are effectively untreatable. Garden variety crazy is basically impossible to fix, so every job for them is basically
>beat head on brick wall, get copay check.
This leaves them frustrated, so they often jump to conclusions on newer patients that seem "difficult" in some way. It's frustrating to see, because when they ARE right, they can do some real good.
3- They are not immune to political considerations. The new generation of Psychologists is almost entirely feminist. We went over hobbies in one of my psych classes.
1/2
>>134720162
That's interesting, so, you were doing bad enough to have to be in the psych ward (so things aren't going good to start) they give you 2 different drugs (side effects are always worst upfront) and now you're trapped in. Your reaction - violence and manipulation - might have been a very normal reaction to being in such a shitty situation, and the prozac amplified it.
>>134720282
>Lots of people have no idea where they should be, feel no particular calling, and are dissatisfied with life.
Wisdom. Thank you.
>>134716072
Lexapro is god tier. Helps depression and anxiety without crippling my dick.
psychiatrists and therapists are 2 different things
SSRI's work, but from my experience, a uncontrollable painful experience works way more. Im not saying cut your wrists or anything gay like that, I mean more so a terrifying or painful experience that you stumbled yourself into, to give you the good ol "man this empty no friends gayness is not nearly as horrifying or painful as the near death experience i just went through".
If you arent making experiences for yourself, good or bad, your mind is gonna stagnate and dull out, so I'd suggest not stagnating or isolating yourself from the real world
>>134720269
Paranoia is a relatively rational response to the universe. It IS out to get you, and gets everyone in the end. That said, the rational counter-response is to accept that, and make sure you get what you want out of life in the end. Try not to hurt others in your way.
>>134720282
2/2
3- They are not immune to political considerations. The new generation of Psychologists is almost entirely feminist. We went over hobbies in one of my psych classes, just as a general "ice breaker" kinda thing. The Instructor asked us not for general hobbies, but more specific ones. I'm a fa/tg/uy who likes role-playing games, hunting, and skeet shooting. Next thing I know, I'm the freak for no-good thoughts, despite the class being for a major that specializes in "tolerance" and "acceptance" and "unconditional support".
The new psychs are disproportionately gay and has gender disorders. To be fair, these groups (LGBT) have disproportionately more issues, and likely would benefit from treating themselves.
HOWEVER, men are often hesitant to work with female psychologists. some 70% of all counselors and psychs are now women. The only remaining male psychs are disproportionately prison psychologists, research psychologists who squirrel away in some academic hall, Industrial/Organizational, Psychometrics, and the odd Carl Jung/Carl Rogers survivor who does some variation of CBT, or the occasional Family therapy. Most of what i listed doesn't involve personal healing, so much as measurements, research, or group structures. In short, men tend to go to set up functional "systems" or see how things tick on at the most physical level, while women tend to do individual feelings. As a side note, I have never met a female psychologist vote anything other than blue-ticket democrat. There is a VERY strong internal bias against any conservative thought. The only survivors for conservative thought are in family psychology since Western family psychology practice is STILL rooted in some Christian basic ideology (the importance of the family unit, the primacy of the family as the basic unit of culture, etc.). It is under internal assault by "new" family structures, particularly from the LGBT psychs i mentioned earlier.
>>134720499
Yeah, that makes sense. I'm schizo and paranoid as fuck so that might have been why I was on the olanzapine.
They sent me home with the olanzapine and fluoextine but I stopped taking them about a week after and I felt a lot better/less homicidal. I'm dealing with my mental problems alright by myself right now I think.
>>134721004
Your posts are both enlightening and horrifying.
>>134719702
see this is what amazes me. you still managed to land a career with depression. I'm in my 30s and depression has basically ruined my life. I've worked wage cuck type jobs barely squeaking out a living.
my unmotivation and aboulia are so bad I can't get myself to do anything worthwhile
>>134721004
tl-dr; The actual good psychs are rare, it is becoming a feel-good factory dominated more and more by democrats, and I have legitimate concern that it will be used to establish the "new normal" which will fly in the face of the actual purpose of psychology and find itself being used by the powers-that-be as a cudgel, just as it has been at various points throughout its history.
>Has ANYONE gotten better due to these people?
Yes, I have. Been going to therapy for like six or seven years
>Has your depression, anxiety gotten better?
Absolutely! Along with a bunch of other bullshit
>has ANY pill worked for anyone that hey prescribed you?
Yep. 20mg of Abilify and 400mg of Seroquel.
Fuck you OP, meds and therapy enable me to live a normal life
t. schizo
>>134715215
one of many jewish scams of this type:
take biological condition -> pretend its fixable -> charge tons of money for non solutions
>>134721158
as the JFK meme says
>if you only knew how bad things were.
The internal psychology world is tearing itself apart between
>docs who think everything should be prescribed away
>feminists who will burn thousands of years of civilization and culture because its "old" and we should love everyone for every choice ever
>the few who actually think a balanced approach should be used
>the psychs who just are academics who talk a lot but don't actually practice
The I/Os are nice, largely because they don't have to deal with that shit. Prison psychs are great to work with desu. They are almost universally male (because no woman, no matter how tough they say they are, is willing to be along with a tripple-axe murderer in a confined space) and they usually have very firm personalities and no-bullshit attitudes.
>>134718252
I trIed CBT, but it was too painful. Now I stick to spanking and sometimes the riding crop.
>>134715215
Yeah my shit was so fucked up I got on pills for a year to rewire my brain. All my friends said I was different I didnt notice cause it takes weeks for it to kick in then you don't notice its fucked up. It was my friends telling me to get off them. Started smoking ganja for 2 weeks straight and when I stopped it had greater effect than the year on their pills. Ganja works so much better Im never quitting ever again but not necessarily going to smoke every day.
>>134719702
Very good advice indeed. Some people are simply high in negative emotion - neurotic temperament and it's just how they roll. Having said that there is a lot that can be done. I turned things around when I took a closer look at my fucked up posture, faulty breathing and movement patterns plus dietary allergies. These things really sap your energy and leave you vulnerable for your natural tendencies to kick in. And on top of that I got physically strong. Not fit, not toned but like weightlifting and powerlifting strong. Took a long time but difference in everyday life is like a night and day.
>>134715215
I redpilled a psychologist once.
I wouldn't trust them though, in fact I wouldn't trust most of politically infused (((science))). Psychologists strike me as the people who claim to know what you're thinking and then if you tell them they are incorrect they become only more fervent in their self affirmation. There's no way to really demonstrate either side is right or wrong.
In my experience, the best way to deal
with them is to beat them at their own game. Read some psychological studies on the clinically insane and act out those traits (of course don't let them know it's an act or that you've read such studies) they become puddy in your hands because their self affirmation bias is self defeating, they will believe you to be crazy and by virtue of being crazy they will not be able to properly assess your thoughts and actions from a rational standpoint, this makes them vulnerable because everything you say to them becomes nuanced and full of meaning. They over analyze.
>>134717472
Damn they poison you to make you twitch for life now you got to take medicine to stop the twitching.
>>134721811
I dont know how to reply but this is very fascinating. I am horrified that feminists infiltrated it, mental health could do so much good for the world... I dont think we should love every choice ever because some are objectilvy wrong for the individual and the world, and if the new wave are just subjectivists we're fucked.
Do you think your profession will ever be able to pick apart and diagnosis someone at the neurotransmitter level, and for example prove that someone is low in dopamine, or has a mutated receptor, etc? That would cut through lots of the bullshit I reckon.
>>134721482
>he doesn't have insurance
>>134720673
that's weird cuz it crippled mine
>>134719917
I grew up in Hungary and it was common to shine infrared lights on kids' heads who had a fever. Never helped, and I can still remember how shit it feels.
>>134722299
I am usually the guy that points out the thing nobody sees in order to fuck things up. Now I see something nobody is pointing out but I don't want to fuck things up.
This is hard for me. I can't say shit.
>>134720701
Extreme paranoia and any other anxiety based disorder comes with a lack of ability to control your issues.
I understand anxiety is a life saving response.
I am unable to ever stop being anxious.
I understand paranoia helps keep you cautious and could save your life.
My paranoia causes me to rarely sleep more than a few hours without feeling as if I will die.
This is where therapist fail.
Therapist try to explain to me why I shouldn't be a way.
I respond I know this and it's not a choice, I can not physically stop myself from being on edge.
Medication works, but medication is not without a price.
You will lose a part of yourself to control the issues you have.
I am completely unable to empathize anymore with anything. I am also less paranoid while on my medication.
That was the trade off.
In the end though, nothing has really change.
I rarely leave the house now as I'm prone to violent outburst and my apathy towards everything causes me to take major risk.
While I was paranoid I rarely left the house because of the extreme paranoia.
Some people can be fixed, others can't. Any medicine man that believes otherwise is either a first year student or a moron.
Dont bother with these guys. They have the power to commit you involuntarily. After you escape the crazy house with power tripping staff straight out of to kill a mockingbird theyll bill you for the pleasure as well.
>>134722441
Yeah, that's behavioral psychology. It's at a weird intersection of psychology, psychiatry, pharmacy research, Skinner's Behavioralism (ie., everything is predetermined by genes and your learned responses to environmental conditions), and neuroscience.
They do some good stuff, but a lot of them get tied up in pharma research so they don't really "practice" so much as study.
We won't ever get to the science fiction of "lol delet this one neuron to make you forget that one memory" but we ARE making really good cognitive maps and getting good at mood recognition for AI, etc., and are learning a lot about human stress responses, and how they can make you more sensitive to future stress, etc. as an example.
A lot of the "low dopamine" proof can actually be seen in brain scans. like for schizophrenia, there's a pretty notable enlargement of the ventricles (gaps in your brain). That's an easy example though.
>>134722582
>had a fever
Yep youre retarded
A psychologist is a joke. A psychiatrist still had to go to medical school
>>134715215
Ayahuasca
>>134723047
Because pads of paper. Papers for my paper. Medical doctors deal with things they can see. Psychiatrists deal in ink stains
>how many bicuspid valves do you see on this inky angiography?
>17?
>this kills the inky
>>134722783
Oh buddy, let me tell you about wards.
First off, not all are out to get you. Believe it or not, most people can't pay anyway, so they want to reserve space for the REALLY crazy ones.
BUT there are some that do.
First off, lets talk about California. Cali ran what amounts to a eugenics program. for YEARS. Decades. They didn't stop. there's evidence from their female prisons that they HAVEN'T stopped. They sterilized a very large number of mentally disabled, latinos, etc.
New York puts that to shame if you are average joe though. See, in NYC, the government compensates hospitals for beds filled, on the rationale that it means more people are being treated.
Doctors and Psychs can "pink slip" people. this means 72-hour involuntary psychiatric hold.
Combine that with my previous point; the state has given NY hospitals a financial incentive to arbitrarily hold you against your will, get money from the state for filling the bed for 3-days, then get money from you (unless you are homeless, which usually just means they will see you again as surely as Cerulean city sees pokemon trainers coming out of Mt. Moon).
NYC absolutely abuses this. They commit more people per capita than just about any state.
Yes particularly when I was addicted to opiates but that's because I wanted to get clean and he basically drug tested me every other week and gave me suboxone. I got clean fully and have been for a while.
But he also operated as a mentor because he was down to earth and libertarian conservative who didn't take any lefty bullshit. He was behind trump after Scott walker fell through.
I've been seeing him for like five years and he's helped me get on my feet now I'm clean and working full time for twenty dollars an hour. Much better than before I started seeing him.
Obviously he doesn't get all the credit but he definitely acted as a counselor, mentor, and at first a parole officer. They are helpful if you want to help yourself. If you want someone Rostov do the heavy lifting or give you a magic pill, well that doesn't exist.
>>134715215
nah
buncha faggots with mommy issues and sluts
useless degree for people who try and play word games
>>134715215
Got help from a MFT, changed my life and the lives of my family. So much so that I have gone back to school to become an MFT myself. You have to find a good one though, there are a bunch of ineffective ones out there.
Psychotherapist
>Psycho the rapist
Sounds legit
>>134723235
*Cali didn't stop until the 70s until the Supreme Court basically told them to fuck off with the Nazi-tier eugenics programs, which extended to their psych wards.
Examples included:
>hey you're an illegal immigrant right? Can't read? no problem, just sign this waiver before your C-section! ignore the fine print!
then they sign and don't understand where it says the hospital can sterilize you as part of the procedure
>>134716086
>It can be beneficial for some people to have an uninvolved third party to speak with about their problems
It is beneficial to all people. But it is expensive, and hence it doesn't make sense for most people to go to a therapist because most of your life problems you just need to learn to deal with on your own.
>>134715215
I'm going to see one soon to deal with a phobia I have
but if you're depressed or have "anxiety", you're just a fag who needs to hang himself desu.
>>134723235
You said you have a degree in neuroscience right?
any idea what would be causing constant brain fog, depression, anxiety, and aboulia?
>>134723608
Phobias are one of the few things in psychology that can actually boast an extremely impressive success rate with regards to treatment.
>>134715865
>I think they are a scam used to take advantage of weak minded people who can't solve their own problems.
This right here.
>>134720269
I have insane paranoia too. Crippling mentally. Impossible to learn.
It's like patrolling the jungle during Vietnam every waking hour.
It's like you're constantly (24 / 7) flinching, wincing, and tensing up, so you're ready when someone slaps the fuck out of you from behind (which never happens).
When I smoke weed, I'll hear people yelling at me and cursing and insulting and threatening me from behind.
Fml lol
>>134723608
and youre an ignorant douche bag who scared of something lame and needs to die in a car accident.
>>134715215
>has ANY pill worked for anyone that hey prescribed you?
Yes, but they made me humongously fat so I had to stop taking them.
>>134724202
>t. faglord who defies natural selection at every turn
>>134721004
God bless you and your post
>>134724294
says the faggot who has a pussy phobia.
>>134715215
Drugs work for 60% of peopl but lower T. Worked for me for a few years then got off and life is good. Helped me get over a difficult bump in life.
>>134724034
That would be depression. If it's sever, that's major depressive disorder. If it's mild and persistent, that's dysthymia, which a lot of people have but never notice until it passes, often after years.
I don't know enough about your specific story though to really make a judgement call on that :( sorry anon.
If you are looking for treatment options, the most common are going to be new generation SSRIs, which ideally will balance out some neurotransmitter issues your brain may or may not have. But SSRI treatment can be... temperamental. It's basically an art of tweaking your dose to minimize side effects, or switching to a different SSRI entirely if side effects are too negative (ie., are you suddenly gaining a shit ton of weight/losing a shit ton of weight, having trouble focusing, etc.). Rarely, they may try monoamine oxidase inhibitors, though those have kinda gone the way of the dinosaur.
The big problem is, even if its a specific part of your brain that's acting up, your brain really only "speaks" in a few neurotransmitters, so trying to "fix" that one area generally involves causing a cascade of imbalances somewhere else. Medication is all about trying to minimize the imbalances in that one nucleus/area while minimizing side-effects elsewhere.
Sometimes the side-effects are weird, like an inability to have an orgasm without a lot of effort, yet popping a boner at the drop of a hat.
Others are kind of predictable, like women gaining a fuckton of weight after you give them a medication that alters their hunger (serotonin, i'm looking at you).
I don't like to give that type of medical advice over the internet though, since i'm essentially throwing darts at a board in the dark, and I will mostly be spending time with mice for the foreseeable future, sorry :(
>>134724182
Umm you might be a paranoid schizophrenic, weed makes that worse
>>134722736
Yes, it comes from a lack of ability to control your issues, and it also can come from a childhood where a safe environment was not afforded. Sometimes the start of such a thing is in early childhood, where some babysitter slaps you multiple times to get you to stop crying. These types of things can leave fairly indelible marks on the psyche.
In order to rectify such things, you can go through therapy - though it takes a very good psychologist to get to the root cause, and figure out a solution. However, as you say, most psychologists will explain the cause of your issues, and fall short of solutions. When dealing with fears, one must confront those fears to make progress in life. The mind needs real-life action to solidify theory - so exercises to deal with these fears are usually needed.
I used to be extremely wary of people, myself - and particularly groups of people. These fears aren't unwarranted, as groups of people are inherently dangerous, but after being in such environments for a while that treating people with suspicion off the bat can very well make them socially dangerous to you. Intellectually, this can be easy to understand - but there is that part of you that is resistant to the idea until you actually test it out.
Part of my solution came rather naturally. One night I had a dream where I looked in the mirror - and what I saw instantly decayed into a skeleton. I got up the next day and imagined the same thing when I looked in the bathroom mirror. I then applied that to everyone I talked with over the next week (obviously without letting them know). We all die. Nobody is spared. Stop fucking worrying, it's the natural state of things, and there's not a damn thing you can do about it. Once you really let this sink in to the depths of your soul, you just can't be paranoid.
I disagree that not everyone can be fixed - though it more depends on the person rather than the shrink.
Depression and anxiety and all of those sort of things are important biological functions that are grossly misunderstood. They are there to drive you to change and rectify a bad situation, on a primitive lizard-brain level. We are instinctual animals, just like any other. Medicating yourself does not solve your underlying problems and will only cause more issues.
Now, there is a discussion that could be had about how modern society conflicts with our primitive needs and ultimately cultivates depression, but that is beyond this thread. The bottom line is that pharmaceutical companies are laughing their asses off right to the bank as more and more people get on their pills and can't get off. Why would their sales people (psychiatrists) be honest with you about those pills? Do you trust a used car salesman, too?
I went just to get scrips. The combination of Paxil and Seroquel works well for me. I was never interested in talking the (((psychiatrists))). Talking to a friend is better for me than paying 150 an hour to talk to a Jew about what happened to me when I was 7 years old. Can never get off of either drug. Withdrawal, even slowly tapered, is a special kind of hell, especially from the Seroquel. I like withdrawing from Paxil. Electric shocks, dreams within dreams with dreams, funny dizzy floating experiences, and I feel like the aliens are trying to contact me.
>>134723608
With anxiety, an interesting finding is "learned helplessness", that is, if you get beaten down just enough you essentially surrender. Your brain conditions you that way, and if you get beaten down in the future you are much quicker to resume that helpless behavior. This extends to stress more generally, where you adopt depressive behaviors much more quickly in the future (at least, for animal models, it's unethical to test this on humans for obvious reasons, but there is quite a bit of evidence that PTSD risk is strongly related to the frequency of the events and individual power over said events).
For the learned helplessness study, i can't remember the exact name (Seligman? Solomon?) the guy put dogs in a large cage with a barrier fence in the middle that the dogs could jump over. Think of a basketball court. The floor was wired separately to the two halves, and could be electrified "on" and "off" separately. Dogs that could "escape" to the unelectrified side felt less stress. Dogs that couldn't escape at all felt more stress. Eventually, the dogs that couldn't escape would just lay there and not do a damn thing, even when the harnass was removed and they COULD escape, even when it was shown to the dogs that the other half wasn't electrified at the time and they could save themselves with just a little effort to jump over the fence.
There were a number of variations to the experiment, but that stood out to me most.
>>134725417
SSRI withdrawals are pretty weird. Although I quit mine cold turkey a while back and besides the infrequent brain zaps was totally fine.
>>134715215
Cognitive Behavioral Therapy is very useful, helped me get through some shit.You don't need pills or sessions, just get a good book on it and help yourself. Note it will take time and effort, there's no quick fix.
>>134724766
tis all good. Thanks for the reply. I was told I have chronic ,hereditary depression and that i'll be dealing with it all my life.
was on lexapro for years,but that shit only helped for a couple months, why my psych kept me on them for so long i'll never know.. I was given abilify by a different doc,but havent tried it yet because I dont have insurance and cant afford a constant 200 dollar psychiatrist visit just so they can write me a new supply. Plus the cost of the pills.
>>134724456
>muh vagina: the pathology edition
Most guys would say homophobia doesn't mean they're scared of gays. The word doesn't even imply that. It means fear of same. Fear of man of own gender. Speaking only for them as it's their opinions that count. Now. Why is it that a pussy phobia is all real and to be ridiculed and stuff? Heterophobia blah blah all these words are meaningless
>>134726302
Eh some to do with heredity some to do with mindset. If you use only medicine it won't work out.
I was on an antidepressant for ten years until they stopped at the end of last year. Now i've had 6 months of side effects until they finally stopped and my body absolutely refuses any new tablets above a small dose. The lesson i've learned is that at high doses at least they are more a tool of avoidance for anxiety/depression than a treatment. Once the crutch was gone i realized i had no skills on how to learn to cope with my problems. I've probably learned more about myself in 6 months than in ten years just because its forced me to face my problems.
>>134726331
whatever you say, gaylord.
>>134715215
Not at all. I have serious problems and am a very abusive person and I went through therapist for anger management and they did nothing at all. Just some asshole talking to you and trying to make you feel better instead of giving you solutions and then they prescribe you shit that fuck you up even worse
>>134717834
These are the types of people who oppose psychiatry.
Just let that sink in.
Psychology can only work for those who are committed to it working for them.
It's not the psychologist's job to "fix" you. There is no such thing as a "fix" for nearly all mental disorders. If you go to a therapy session in skepticism and disbelief in your heart and mind, then the therapy won't work because you are sabotaging it either consciously or unconsciously.
None of you probably even understand the meaning behind the term "disorder" as it is used in psychology, anyway.
>>134721207
I was there into my 30's too.
I had to learn how to break out of it myself. I learned to appreciate SOMETHING good about the day, simply thinking something positive helped me readjust my thoughts long enough to get moving that day. It helps if you put yourself in a position you can't say "no" to doing what you're supposed to do. If I leave it to my motivation I'd never do anything. Its fucking crippling. It also helps if you LIKE your job. I willingly changed jobs to a career that pays less because of how miserable I was in the fields I normally worked.
>>134727168
Second of all, retards like most of y'all show up at therapy thinking that you'll show up to this shit and be told how to fix yourself or they'll fix you and you can just go back to your life as usual.
The ENTIRE point of going to therapy is to try to come to a sort of understanding about yourself and about your mental behaviors that are leading to, or perpetuating such nasty disorders like borderline-personality disorders, neurotic disorders, anti-social disorders, etc.
>>134715215
these people dont help at all, only reason i got over my depression because i had started talking to people online that had the same thing happen to me. not only that the pills the bitch gave to me made me a lazy fat ass and now i am tired all the time.
On SSRI's for Anxiety, what kind of shit am I dealing with here?
>>134727965
I've been there it helps. Don't use as a crutch though, use it to get your thinking patterns right again
>>134715215
Therapy is just masturbation.
>>134727506
When you go to therapy, you're supposed to be walking in there, already, with an acknowledgement that there is a problem with yourself that needs to be investigated and sorted out.
The entire point of therapy is to help guide you into understanding how you're fucking yourself over and from there helping you LITERALLY change your own life. The patient is supposed to accept that their life can never be the "same" ever again. The whole point of going to a therapist is so you can CHANGE YOUR LIFE for the better. Not "REMOVE" any disorder, but to understand, become aware of and control it.
TL;DR
>if you go to therapy and think you can just leave therapy sessions without making any solo effort on your own to improve, control, and alter your disorderly cognitions-- you are legitimately missing the entire point of going in the first place.
All those fags want it's to get you to pay for expensive drugs
The only person that can help you besides yourself it's a friend and a good time
>>134717472
>Did absolutely nothing to help my problems, and now I have tardive dyskinesia (muscle movements/twitching on a permanent basis) and tinnitus (ringing in my ears constantly).
Holy shit.
I have the same shit (the twitching).
It seems to happen in concert with my heartbeat, in a random area of my body but usually my head. I look like a fucking nutjob and it has probably ruined any chance of any female ever wanting to date me, because people that twitch look like psychopaths.
I don't know what exactly caused it or exactly when it started but it was in my mid teens, I had been on various SSRIs and antipsychotics for a few years by then.
I'm 28 and haven't taken that shit for well over a decade but I'm permanently fucked.
>>134727965
the SSRIs are only there to be an assistant in your quest to alter your anxious cognitions. You have to become aware of your own anxiety and actively engage the thoughts and stimuli that make you suffer from anxiety and learn to control your own thoughts.
You have to quit allowing your brain to shout any negative thought that comes into your head. You have to argue and wrestle with your train of thought and stamp out harmful thoughts like a fire. This means undoing your thoughts which is waaaay harder than it sounds.
>>134728061
>>134728730
Thanks anons
>>134728894
Also fellow natsoc try going to a jungian center on the side or something.
>>134723608
>pot calling the kettle black: The Shitpost
Everyone thinks SSRIs are meant to make shit like depression and anxiety disappear or vanish, and that's just totally missing the point. It's about getting your cognitive behaviors under control. You have to tame your mind, most idiots in this thread can't do that because they don't have the willpower or the real interest in fixing their mental issues. They want some non-existent cure or someone to do it for them, which is just not ever going to happen PERIOD.
Take some responsibility for your disorders and sort yourself out instead of waiting for somebody else to fix yourself for you. God damn. You're all excuses.
>>134715215
Bigges scam ever
>>134718040
Based post
All Scientologists must hang
>>134718072
You're a pathetic and obvious shill
Everyone knows Scientology is a tax shelter for money laundering
KILL YOUR SELF
If anyone has chronic anxiety, and the doc gives you a scrip for Xana, Klonopin, or any other benzo with refills, tear the scrip up and find a new doctor. Those drugs are for occasional use. If you take them daily, you will be addicted and you'll never learn to deal with your anxiety. Eventually you'll want to get off of them, but the withdrawal will destroy your mind and bring back the anxiety times 10. You don't want to live in a benzo fog.
>>134728894
Listen to me and take this very deep to heart, Anon.
Your SSRIs are meant to assist in the self-management of your own mental cognitions. They will not fix them. They're supposed to EVEN OUT your moods and bring some regulation to your temperament.
You will-- for the rest of your life-- have to actively engage and manage your own thoughts- more so than others. It's just your lot in life. You will have to be more mentally vigilant than people without an anxiety disorder. If you're hoping to be fixed, you'll hope for the rest of your life for something that W I L L NOT C O M E
Take your omega 3 fish oil to deal with depression. You need 1000mg epa and 500mg dha.
Also take turmeric extract (circumin) to deal with anxiety. Apparently they're just as effective as prozac, with none of the side effects.
>>134729153
My experience is that they didn't even try to help me cope with my life without medicine and solve the reasons that I was severely depressed. My life was a fucking wreck for a reason and it wasn't something I could just fix through taming my mind and working through it. They went straight for the hard medicine and it wrecked me even more. I spiraled and ended up not going to high school for so long that the court ordered me sent to a treatment center for a year. I ended up being a NEET till 21.
I can't as an honest man say it was all the fault of the medicine or the psychiatrists, but they sure as fuck didn't help and those medicines made me really fucked up. I started actually hearing voices and having fucked up dark thoughts on those medicines and that only cleared up once I finally stopped at like 18.
>>134715215
Dude, weed! But seriously, weed! lmao dude!
>>134715215
Psychologists and (((therapists))) are a scam, but psychiatrists are actually real doctors.
I started getting blackouts and seizures a few years ago. The neurologists did tons of tests but couldn't find any tumors or blood clots or anything like that. Eventually they referred me to a psychiatrist who thought it might be a form of psychosis. He decided to try anti-psychotic medication, and sure enough, I've been clear of symptoms for over a year and a half now.
>>134729693
they obviously loaded you up because you gave them so many red flags that they thought you needed a heavy dosage for what they perceived to be heavy mental disorders/depression.
there are tons and tons of SSRIs and if you never spoke to your doc about those hallucinations- which are side effects from SSRIs that aren't suited for your neurochemistry needs-- then it's no wonder you never got any real help. You didnt' help them, help you. If you can't even do that, you're a lost cause, always.
Therapists give people pills because most of you fucks leave our sessions and don't do any damn fuckin homework. You sit around and do the same mental behaviors that fucked you in the first place, except now you're taking a drug thinking it will do all the work for you-- which it won't.
We have VERY STRICT ethical guidelines and regulations that prohibit us from just lobbing pills at our patients willy nilly. The pills are also supposed to be a safety net for when you fail to do your "homework."
>>134730253
(((psychiatirsts))) are the biggest jews out of all of them.
Nigger
>>134730404
I like this anon.
psychiatry is real, it's just that most fucks don't understand the entire point of therapy, and a shitty therapist/psychiatrist is someone who doesn't make that a top priority initially.
>>134715215
i know a good Dr.
>>134717472
>now I have tardive dyskinesia
Did it go away? They ahd me on all kinds of shit, but i stopped it and i don't think i have any side effects anymore. It's all bullshit. Look into things like Prozac and you see it wasn't even invented with depression in mind. They throw shit at the wall and see what sticks.
>>134715215
99% of them are just some jew taking shit loads of your money to do nothing or fuck with you
>>134717182
same bro, took me 8 months to feel normal after only a 18 months taking them.
Hang in there it gets better. Don't give in. Smoking weed helps the withdrawls. Drinking made them worse for me.
>>134715215
It's better to avoid them at all costs. Some of them know their shit and really want to help people but there are some genuinely bad people in that field.
>>134730661
thank you anon, i'm glad some people get it. This entire website is chalk full of borderline personality people and neurotics, and almost ALWAYS afflicted with anti-social disorders which renders them with skepticism to a pathological level. and of course some are flat out sociopaths.
I've gone through several rounds of therapy at different times in my youth and as a teenager. Even sought out a pastor /psychologist during a difficult period of compulsive behavior.
I've been on Amytriptyline, Imaprimine, Nortriptyline, sertraline, whatever Paxil and Cymbalta are, Ritalin, Adderall, dolmar, and a host of street drugs and prescription medications that I usually took per the prescribed method besides opiates.
CBT actually helped because of the Ritalin and Tricyclic antidepressants softening up my brain and motivating me to comply.
Focused daily exercises to deal with ennui and procrastination, anxiety, weight problems, etc opened the door to deeper research into the methodology used to help patients.
Physician heal thyself is the real answer. If anyone cares l will share more.
>>134730404
Do you accept that there are a lot of shitty therapists out there?
How is a 12 year old kid (that's when I started seeing mental health people) supposed to understand how to help their self when all the therapists they see suck ass?
Their job, you say, is to help guide the person into being able to fix themselves. If they can't do that, whose fault is it really?
I'm leaving this thread because I'm starting to feel like I'm getting a depressive episode and I need to cut it out. Thinking about my life back then is a really fucking bad idea and it makes me regret everything in my entire life. Too late I guess, I'm 28 and even though I managed to claw back from total pathetic NEET and have a good job I'm a complete fucking mess inside and I'll probably kill myself not long after my mom dies. Fuck it, no therapist could ever help me.
most of you fucktards saying you're suffering from "MUH ANXIETY" and "MUH DEPRESSION" and "MUH ADHD" are just potheads who aren't realizing that weed absolutely, positively contributes to already existing disorders, or creates them via drug dependency because it rewires the entire neurological reward pathway in the brain.
IF YOU'RE SMOKING POT CONSTANTLY DAY AFTER DAY AND THINK YOU HAVE A DISORDER OR A MENTAL PROBLEM- QUIT BEING A RETARD AND QUIT SMOKING WEED EVERY FUCKIN DAY
people who say the drugs don't do anything have never tried klonopin
>>134715215
Couples therapy is ok. You need a mediator for serious discussions that would normally become an argument.
>because it rewires the entire neurological reward pathway in the brain.
and pharmaceuticals don't? some of us want to take something natural.
>>134721377
they didn't cure you did they.
they got you hooked on something.
''normal life''?
are you really that stupid?
there is NO SUCH FUCKING THING GROW UP YOU WHINY BITCH!
>>134729689
This dude gets it.
I slip back into bouts of anxiety, depression, Paranoia, insomnia, but just recognizing that I'm in that state is the first step out of it. Over a life time you learn tricks and habits to overcome various states, and a pragmatic and honest self awareness is the first thing you need to learn. It's going to hurt a bit at first because you see that you're a piece of shit. The important step after seeing your flaws is to actively address your shortcomings.
I lied a lot, compulsively. That hurt my self esteem. I remember making an exercise out of being present and actively not lying for no reason. Lie if it's needed for a reason, we all do, but never lie just because. That's a good first step to manage yourself
Wish i got here earlier ALL psychologists are hacks do they CURE anybody? NO they make their money from repeat returns so you tell me
>>134716455
how are they different?
>>134716086
>It can be beneficial for some people to have an un-involved third party to speak with about their problems
Isn't that what 4chan is for?
>>134729647
The crushing, life-threatening level of anxiety you suffer coming off Xanax cold turkey is a good way to get perspective on it though. If it doesn't kill you, at least you can always refer back to it and remember it isn't as bad now as it was getting off Xanax. Fucking evil stuff
>>134731332
good lord you are such a self-fulfilling prophet. how about try faking positivity for once in your life--- actively---- until you learn how to genuinely be a positive person FFS.
of course there are tons of shitty therapists-- mainly because there are tons and tons and tons of shitty patients who want "fixing" and won't work with you and still expect you to help them. Do yourself a favor and quit blaming your psychologist or therapist for your lack of active effort into changing your self-defeating thought patterns.
Maybe you don't actually WANT HELP. Maybe you just tell yourself you want it, but deep down, being a broken person is all you have ever known. Self defeatism is familiar for you and your external locus of responsibility contributes to your perceived powerlessness in your life.
>>134731206
It's a shame but since any white nationalist movement is so fringe but brings out some weirdos sometimes
>>134715215
santo daime is the religion that can heal this planet.
https://www.youtube.com/watch?v=SJLodUHr0H4
here i saw many 'answers' nature is a machine built by a high intelligence. this machine needs regular maintenance, entheogens were left for us to assist with this repair.
>>134731479
This.
>>134731621
That's good too? Who's saying that's bad?
>>134715215
Just take shrooms and go on more walks
>>134731830
Yeah, if you aren't retarded enough to get your feefees hurt. But for someone on the edge, animal torture and nigger hate threads could push their little pin brain over it
>>134717472
Sounds like your problem was that you were a big baby and incapable of having objective and rational thoughts about yourself.
>>134716372
>mommy and daddy send anon to therapist
>refuses medication
>gets advice
>doesn't take it
>"this shit doesn't even work!"
>>134731621
>some of us want to take something natural
good luck with that natural thing making your life better, cause it won't. You'll just depend on it for literally every feeling of reward for the rest of your miserable life.
"muh Pharmaceuticals" is such a weak stoner pothead argument. SSRI's and nearly all antipsychotics don't stimulate your dopamine glands into more output (AKA your reward pathway) you dipshit.
habitual THC smoking makes you release increasingly less dopamine sober. that's why without pot
>food tastes less rewarding
>movies are less rewarding
>video games are less rewarding
WHY?? because without pot the reward centers of your brain that are largely associated with dopamine output are RESTRICTED to only releasing dopamine when accompanied with being high. Without pot REWARD CENTERS BARELY EVEN "FIRE" ANYTHING. That is the NEUROCHEMICAL MEANING OF ADDICTION.
Every time it's
>This psychiatrist fixed me
>So you now have a job, friends, girlfriend?
>No, but I don't want to kill myself!
>kills himself a year later
The only people I ever knew who were cured of depression are those that found a wife in the psych ward. Ugly, crazy girls, but I guess most men have no standards when it comes to love
>>134731961
Why should I even listen to this when it's just generic advice based on nothing? You know nothing about me and you're already placing me into some archetype. I don't actually want help and deep down want to be broken? Based on what really?
I clawed myself up from the absolute fucking pit of despair in my early twenties and can now provide for myself and I take some pride in that. Not everything can be fixed by therapy and not everyone can just start changing the way they think and turn their life around. I feel like i've reached the limit of what I'm capable of as a human due to my irreparable flaws, and it just isn't enough. My high ambitions and all my promise as an intellectual being can't be realized due to those flaws both physical and mental and it's days like this where my thoughts just consume me and make me wish I was dead.
I'm not even sure what we're talking about anymore, this thread is just triggering dark thoughts for me. This doesn't happen often, maybe every month or two. I'll get over it and get back to working and sleeping and providing for myself but then in a month or two it'll all come flooding back again because I need something else that I can't get.
>>134730404
>VERY STRICT ethical guidelines and regulations that prohibit us from just lobbing pills
American here, not a Jap. I went to a couple hospitals and saw 4-5 therapists/psychiatrists. I had been extremely depressed for almost 15 years and was diagnosed as such on two separate occasions. Every single person I saw tried to get me to take medicine within 15 minutes of meeting me. I had tried them once before and did not like the way they made me think or feel so I was against taking medication; what I wanted was actual psychotherapy to help me work through my problems and change myself, my thoughts and my life. I was more than willing to do whatever was necessary to improve my situation.
Yet none of them addressed any of that. They all handwaved it away. Three of them directly told me that without taking medicine nothing would change and that they couldn't help unless I did. One guy even said he didn't see the point in in therapy unless I was on medication.
They absolutely did lob pills at me willy-nilly. Every one recommended different medications. Every session I had they would repeat their request that I take a prescription for something. I firmly denied all of them every time and saw the looks in their faces. In the end I stopped going, and after several years of self-improvement and study I managed to work through most of my issues and have become a better person. This happened despite the advice of the shrinks, not because of it.
>>134732501
Also porn addicts.
>>134732038
the white nationalist movement is the orphanage for white social rejects more than it is for *actual* white nationalists.
It's brimming with people who just house a lot of resentment and spitefulness for society as a whole instead of people who want to see whites empowered and confident in their own race and nation.
Here to give my 2 cents.
Was diagnosed with schizophrenia after hearing voices and stuff. Prescribed antipsychs. They've been pretty good desu, like there's been a notable improvement in my condition, so I would recommend meds for schizophrenia. Dunno what happens when I get off it, but one day I will find out.
>>134732501
Those things are all more rewarding with pot from the first time though. Also, after a few months dry, you feel normal again and enjoy things just like you did before. It doesn't seem like there's much lasting damage unless you're a habitual smoker for a long period of time that started too young.
Psychotherapy is legit, I don't think psychiatry or any of the jewish (((Drugs))) are legit. Psychotherapy can do some incredible things for depression, anxiety, ptsd, etc.
>>134715215
Okay if anyone can give me any advice I'd appreciate it since this board is probably the closest thing to peers that I can think of, as sad as that sounds.
In case anyone wants to offer advice but not read a bunch of text, my question is basically if there are any pills/drugs that can help with extreme apathy, anxiety, borderline agoraphobia, self-sabotaging behavior, loneliness, etc. and what those pills/drugs are?
>about to turn 29
>used to be kind of normal up until maybe ~24
>broke up with girlfriend around 23, haven't been in a relationship since, only had sex maybe 10 times since then (in 6 years)
>was in a bad accident around 23-24, was bed ridden for about 9 months, never felt the same after psychologically, felt withdrawn, etc.
>quit going out with friends, quit answering phone, slowly lost all friends
>work jobs, but usually end up on night shifts with very few coworkers, don't open up to coworkers, don't make friends, don't like any chaos/change at work, like strict routine day after day
>end up getting fired from some of these jobs, usually after 2-4 years (usually its just for reasons of downsizing or mass layoffs, not me targeted specifically)
>have a very hard time getting new job, hate interviews, nervous, awkward
>very apathetic, never do anything, don't break routine, just sit home all day every day
>borderline agoraphobic, only leave my apartment unless its to go to work, buy groceries, or some kind of emergency, usually stock up on groceries and then don't leave at all besides driving to work and home, if i have 2 weeks off, or am laid off work, don't leave sometimes for weeks at a time.
>very reactive, never proactive. for example have a home inspection tomorrow from landlord, do turbo clean today, not filthy but very cluttered/dusty, wonder why i let it get so cluttered for last 6 months and then deal with it last minute just because I'm forced to
What should I do besides kill myself?
>>134715215
No joke, first sesh i ever was conned to going to bitch hands me a flipbook for children with emotions on each card.
Female shrink - lolololololol
I destroyed the shit out of her entire approach to my analysis, easily, and proceeded to enlighten her. the laugh was that my family would be so retarded to compound issues in the home by paying some skank fresh out of affirmative action camp $80+/h to listen to how i'd been trying to bolster the family financially by detailing how not to make stupid expenditures just like me being there.
Fuck, and to hire a woman!?
Obviously, mombot just needed to pay someone to try and gang up on me. pathetic
>>134715215
Antidepressant/antianxiety medications are essentially a crutch. They should be used to gain control from a totally uncontrolled state, to get the chaos back in order. They can help tamp down the worst symptoms of anxiety and depression so someone can continue to function, live, hold down their job.
People who only take medication for depression and anxiety have a high risk of remission a few months to a few years after they stop their medication. They will always be at a higher risk for depression in the future.
The key is to also see a cognitive therapist. Combined with medication, cognitive therapy gets success rates in overcoming depression up into the 80% range from the 60% range on medication alone. Electroshock therapy, while not first line, is also extremely effective in cases of severe or intractable depression.
Basically, the medication is only there to prop you up. It is not a cure or a long-term solution, even though it may be advertised or proposed to you in that way. You have to undertake a great effort in introspection and self-improvement, as directed by a trained counselor, in order to retool your thought processes and unlearn negative, depression-inducing habits. This takes time and energy, but it's the best way to truly deal with the underlying causes and prevent relapse.
t. pharmacist
>>134731716
good on you anon !
depression and anxiety etc is just the northwind that makes a viking strong.
you have to FACE YOURSELF and CONQUER your inner "demons" and make them come to heel. If you can't take the reigns of responsibility you'll never accomplish anything else.
>>134715215
>Are psychologists/psychiatrists a joke?
Psychologists yes, psychiatrists no.
Psychiatrists are medical doctors who have gone through the same amount of schooling and training as a surgeon and have intimate knowledge of pharmacology and neurochemistry. Psychologists are "tee hee, daddy paid for 4 years of uni, which major should I take... eenie-meenie-miney-mo, lol psychology."
>>134731764
One tries to sort out the bucko.
The other prescribes medicine and relies on the bucko-sorters to cover for their lack of effectiveness.
>>134732728
Couldn't be agree more. What makes it more difficult is that even if it somehow gets off the ground (Pierce) it can't sustain its own momentum.
>>134732385
/thread
>>134731764
>how are they different
psychiatry is the medical way of looking at mental illness, aka drugs.
>>134732728
Because people know our society if fucked up in pretty much every way.
I'm on anti psychotics and anti depressants (SSRI) yes they work
>>134732816
went through almost the exact same thing. Shit gets better, know that feelings don't last they will always change. Accept your situation. Jung said whatever you resist persists. Learn to accept it and slowly let go.
>Become very depressed quickly
>New I had no reason to be depressed in any way, just felt this unnatural blanket of sadness in my mind
>Psychiatrist prescribes anti-depressants
>Makes it clear they wont fix it all on their own, will need to combine it with therapy
>being the depressed shit I was, i quickly dropped the therapy, shit was useless as expected
>took pills for years after, eventually dropped them when I began to pull myself out of the depression
Psychiatrist wasnt exactly wrong I guess, the pills were not a magic solution but just a way of moderating my mood so I would be more receptive to improvement. But god damn was therapy fucking awful and the pills had really terrible side effects.
Anybody who has talked to one of the really good therapists, the people who have been helping veterans for decades, understands that there is a lot of merit to what they do.
It's far from perfect, we're talking years of pain and hard word, thousands and thousands of dollars for what is probably at best a 60% shot at making real progress, more realistically ~40%.
If you are in the 40% and see the progress though, it is amazing and life changing.
>>134732816
My best guess is that they will just put you on anti depressants. SSRI's helped my anxiety for a bit. After a while they just lost their effectiveness.
>>134732657
ugh you are such a victim. You are a plain neurotic borderline personality type person who is far too self-aware of yourself and it's killing you to be so self-conscious.
I'm not going to bother with reading your whole boo-hoo, pity me for i am the shattered humpty dumpty self-manipulation shit because this isn't a session i'm paid to bother with.
Stop living your life as a TRAGEDY and start calling yourself a fuckin HERO for god damn once in your lifetime and start telling yourself you can move some damn mountains within yourself. Take some damn responsibility for your emotions and your behaviors and do something about it instead of acting like such a victim.
The moment you start telling yourself you're weak, and incapable, and you're a tragic life; guess what-- you fuckin are.
Do something about it faggot.
>un-ironically have extreme depression
>have to go to therapy twice a week
>get put on pills
>neither help
>start browsing pol
>depression has been replaced by rage
>literally to too angry to be sad
>>134733370
not a doctor here, I don't think they lose effectiveness I think you just find new things to make you anxious
>>134715215
It can but I think most people who go to therapy really need religion/spirituality. I think you only need it if you had a really fucked up childhood and don't really know. As a kid my step mom used to beat me and I didn't realize it was weird until I was in my 20s.
>>134733405
>Stop living your life as a TRAGEDY and start calling yourself a fuckin HERO for god damn once in your lifetime and start telling yourself you can move some damn mountains within yourself. Take some damn responsibility for your emotions and your behaviors and do something about it instead of acting like such a victim.
it's an anon with no medical background analyzes and understands an anon based off 4chan posts
>>134733405
No, fuck you, internet therapist.
If you think you can diagnose me over a Tunguskan fish preserving forum, you're a shit therapist.
>>134733492
Therapy is spirituality. A lot of people find god after going to therapy, I personally was raised by degenerate atheists and never got in touch with my spiritual side until really exploring it in therapy.
>>134733370
besides losing their effectiveness did you have any other problems with them? did they make you feel more ambitious? or make it easier for you to talk to people and interact with the world? I guess I want to know how they'll make me "feel", I've read before that some people feel numb or basically that they just don't give a fuck about anything, but if that's the case I'm not sure it would really solve the underlying problem for me...
>>134731633
>Medicine and therapy reduced symptoms of Schizophrenia and helps him cope
>"Dude your addicted to not having hallucinations and violent paranoid delusion"
Thank you Mexico for your stunning contributions to human thought.
>>134732663
i'm laughing pretty hard here anon. Genuinely.
UNDERSTAND WHAT THEY HAVE UTTERLY FAILED TO DESCRIBE TO YOU--- you most likely have MEDICAL GRADE DEPRESSION which is a neurochemical imbalance of your brain that doesn't produce enough serotonin or mood regulators so you are constantly miserable because your body can't make enough of the good stuff to make your mood stable.
LISTEN UP----
SSRIs are always pieces of shit and horrible pills when you first start taking them. SSRIs do not just work immediately, you have to take them for a few weeks up to a month for them to build up in your system. Eventually the whole "zombified" "robotic" feeling goes away and you will feel like a genuinely normal person will feel. It wont feel like HAPPINESS, it won't feel like JOY or GLEE.
It will feel like SILENCE. Your brain will FINALLY Shut the FUCK up and quit beating your mind with thoughts constantly day in and day out.
Therapists give you pills because you genuinely fucking need them. And most first sessions they will give you a prescription because most of y'all need a safety net RIGHT FUCKIN AWAY because all the sad shit you tell them you either exaggerate unconsciously, or don't realize how bad it sounds to a normal person. If you say "YES" to having thoughts of suicide and/or death-- YOU WILL BE GIVEN PILLS- PERIOD.
>>134715215
I refuse to go to one, even if they might help. I have a fear they would throw me in the looney bin or put me on drugs that hurt in the long run. I have trust issues, but i have even less trust on someone only listening because you pay them.
>>134732672
masturbation is like a rat in a science experiment where the rat pushes a lever to be given a "pleasuring stimulant"
without intervention-- the rat will push the lever more and more no matter how less and less that pleasure feels over time.
Masturbation can be the pleasure lever for humans
>>134733434
Not entirely.
Say job interviews for example. When those pills were working at their best. I was calm and collected. When they were no longer effective and I had an interview a couple years later. I was a nervous wreck.
>>134732385
Except I pay my own insurance, I took the advice and it didn't work. "Have you tried not thinking like that?" Only goes so far. At some point you have to look to yourself for help. I'm sure you're not still around though, so its pointless.
>>134733998
fuck lad, you better not be telling me my anxiety's going to creep back are you? how do you deal with it?
>>134733758
They made me a normie for a couple months. I wasnt scared to participate in the world. They made me feel good for a bit.
doesnt last forever though, and coming off of them has been hell for me.
they were a double edged blade for me.
Find some friends who go on 4chan and they'll be as good as a therapist.
>>134733015
our society is fucked up-- yes.
but the only good white nationalist is an active and engaged person in our society who is still competent socially and not a fuckin reject who wears kekistan flags and pepe tattoos and is LEL REDDIT in reality. That shit is repulsive because it's so incredibly desperate for not just attention and affection, but acceptance from SOMEBODY; ANYBODY
>>134734138
Well feeling normal for awhile would be nice, don't remember what that feels like.
I get how it would be hell if they lost their effectiveness though and you started feeling like shit again, losing yourself all over.
Shit sucks but thanks for your input. Maybe I'll get a referral to a shrink and get some meds then. Even just doing that will take some effort but I've become consciously aware of how fucked up I've become and need to make some change before it's too late.
>>134734088
If youre on meds, they only mask the problem. Your anxiety is still there behind the med curtain.
Ive been given gabapentin to temporarily mask my anxiety( its only effective for 4 hours at a time). It just OK at best. calms you down,but can also make you feel drunk and you cant concentrate well at all. I cant read for shit while on the stuff
>>134733621
i don't care for giving you a diagnosis, all i care is telling you to stop being such a quitter.
Say you're not all you want, you sure as fuck talk like a quitter to me.
>>134734449
>If youre on meds, they only mask the problem.
shit man sound advice and that but my anxiety is a side effect of my anti psychotics
>>134733863
>guy says he has personal issues that he wants to work through in psychotherapy
>DURRRR HURRRR ITS PROBABLY NEUROTRANSMITTERS HURR
kill yourself
>>134733602
yeah yeah so it was a cliched attempt at tough love motivation, bite me.
there's nothing to analyze besides how much of a defeatist he talks like. If you were objective at all you'd see it too. Unless you're just plain stupid or a proxy
>>134715215
They're not a joke, but only male psychologists help. Female psychologists can never even understand themselves and there's a horde of them because its cool for women these days.
>>134734472
Do you just watch house and sherlock on repeat? fucking hell seriously what makes you qualified to analyze and give some advice over 4chan?
>>134734608
I'm not sure why you're wasting your time though I mean you don't seem qualified to help him so why bother? what do you gain?
>>134734539
Oh, then it may be different for you. I know nothing about anti psychotics. Only thing I'd be worried about is the withdrawals if you ever come off of them.
>>134734653
very much this.
women psychologists are for women. Get a man or don't go period. Men understand the darkness and the visceral nature inside every man waaaaaaaaaay more than a woman ever can.
>>134734653
>hee hee just try more hobbies, anon!
As an impartial third party to bounce ideas and feelings off of and help you understand yourself better, a psychologist can be useful. Also going through DBT can be beneficial.
If you've got issues and the money for a psychologist, it may be worth your time. Dunno about meds though, never been on any.
>>134734689
it's 1:32AM and i'm awake and bored. Killing time is all i'm doing.
Besides, what are your qualifications to refute my qualifications, Achmad ?
I can analyze anybody i want to and there's just not a thing you can do about it besides yell at your computer screen and scoff at me.
>>134735178
>up at 1am on a monday and judging other people
wew lad
>>134734606
whatever, at the end of the day you still live in Trudeau Land-- which means I am definitely better than you.
>>134735178
>>134715215
I've had clinical depression for 15 years. I've been on all sorts of different meds. I haven't been on any in 5 years, I stopped taking them. I still see my psychiatrist every six months. I sit down, talk to him for two minutes and he prescribes a refill. He literally does not listen at all and just keeps giving me meds.
I've been up and down mentally over the years, I find what is going on in my life contributes the most to my mental state. I've been looking for work for the past two years unsuccessfully and this has amplified my depression.
The meds did help at first when I was at my worst I think, but the side effects were too brutal to keep taking them. There is no cure for depression, they don't even know the cause. I suffer from it, I lost my friends from it and have nobody in my life anymore. My friends all felt it's a "make believe" thing.
>>134715215
Ive been taking brintelix and olanzapine for years and i regulary visit the psychologist.
Im like sun compared to moon before
>>134735304
Judging them, while you judge me anon. We're not so different... you and I. You just think you hold the moral high ground, when actually you just don't like me.
>>134735733
firstly I accept I'm a hypocrite secondly I don't know you so how could I not like you?
>>134735733
You come across as abusive and intellectually dishonest. Can't imagine what sub/unconscious mental problems you must suffer from yourself.
>>134735639
How do you survive with no job for two years? I lost my job recently and am in a similar situation as you, depressed, nervous, suffer from anxiety. I'm terrible in interviews. I have employment insurance but when it runs out I'm fucked, I've had a few interviews but they've gone pretty badly. Now I'm getting more and more anxious as time goes by knowing that if I don't secure a job my problems will only get worse, I won't be able to pay rent or buy food or anything else.
>>134735788
You just don't like people speaking with any sense of credibility or authority on matters that aren't you. Besides you probably don't even believe in psychology to begin with.
Do you realize how many people i've spoken with that are just like those two anon's I "analyzed" that you're white knighting for? (which is such a quintessential british thing to do nowadays)
Anybody with an objective brain and even a dash of psych experience and training and schooling could tell you the exact same shit i came up with. They're practically examples right out of the DSM-V.
>>134735930
Worker's comp. I got on worker's comp for an injury and my depression, but they reduced my benefits a few years ago. I lived off savings, then started looking for work. I'm living in a rented room barely surviving, I am getting the same money as someone on welfare would get.
My injury limits my job prospects, so I am applying for anything I can do that isn't physical, I just never hear back from anything. I am mobile and you wouldn't know I have an injury from looking at me (shoulder).
>>134715215
>therapist
>the rapist
Do I need to say more?
Yes... you'd be surprised at what can be accomplished when you admit you have a mental il was OP.
Try showing a little humility and take the final red pill (admitting every person has their own brand of mental illness).
>>134736154
>see my ID
>"Amen"
Amen
>>134735691
>brintelix
never even heard of that one. Is it an SSRI?
>>134736118
>You just don't like people speaking with any sense of credibility or authority on matters that aren't you.
how do you have authority on it and how is an anonymous user on 4chan credible?
>Besides you probably don't even believe in psychology to begin with.
wrong, lern 2 psycho analyze fgt
>Do you realize how many people i've spoken with that are just like those two anon's I "analyzed" that you're white knighting for? (which is such a quintessential british thing to do nowadays)
>do you realize something I haven't mentioned up until now
no I didn't
>Anybody with an objective brain and even a dash of psych experience and training and schooling could tell you the exact same shit i came up with. They're practically examples right out of the DSM-V.
alright man I picked up the DSM-V when doing psych - I've got the fifth edition give me codes or page numbers
>>134736201
Amen
>>134735903
And so what if i am anon? What're you gonna do?
Sue me? You could honestly start by taking off that proxy ',:^)
And i'll tell you, I have depression which i get counsel and medication for. Most people who are psychologists have a degree of depression themselves. It practically comes with the craft.
Favor me, and analyze how it is that i am intellectually dishonest
>>134733863
>If you say "YES" to having thoughts of suicide and/or death-- YOU WILL BE GIVEN PILLS- PERIOD.
>thoughts of death
Let's just give the vast majority of the thinking human population these pills, what could possibly go wrong
Can anyone confirm magnesium helps with general mental health? How do you take it?
>>134736163
Im well aware I have mental illness. That wasnt the point of the thread.
>>134736297
the medium i'm speaking to you through doesn't remove credibility, anon.
you're wasting your time trying to play DSM-V tag with me but go ahead and
look up "borderline personality disorders"-- specifically the neurotic types section. They are highly manipulative people who use the pity and empathy of others usually through threats of self harm, self defeatism, and act suicidal and call themselves suicidal openly often to gain attention.
The Nip probably had clinical depression or maybe just a moment of depression like he insinuated.
>Do you realize how many people i've spoken with that are just like those two anon's I "analyzed" that you're white knighting for? (which is such a quintessential british thing to do nowadays)
>do you realize something I haven't mentioned up until now
>no I didn't
I didn't mention it because i've been doing it the entire thread which is why you spoke to me in the first place
>>134736589
I just now started taking Magnesium Glycinate pills today. My first pill ive felt nothing. It supposedly takes a week or so to have any effect.
>>134736797
>the medium i'm speaking to you through doesn't remove credibility, anon.
yes because shit posting on 4chan and giving a talk at a lecture hall has equal credibility
I don't even want to keep replying at this point man you're just fucking dense
>>134736556
i'm just saying what they do anon. It is normal to think of death philosophically, but the question pertains to thinking about your own death actively and consistently. It's an incredibly generalized question, but typically answering yes to both of those, and either or typically results in some form of medication being prescribed because they're red flags for suicidal tendencies. And we typically just play it safe and go for it. If you don't like it-- tough.
>>134736918
>yes because shit posting on 4chan and giving a talk at a lecture hall has equal credibility
i never made such a claim. you are projecting so hard right now anon. Go have a wank already, lord knows you can't get a girlfriend with such a clear attitude problem :^)
>>134736121
Sorry to hear that, hope you find something soon. Shitty situation to be in, at least from my perspective the longer it goes on and the more failed/fruitless interviews, the more discouraged I feel and the harder it is to press on. Guess that's all we can do though is persist.
For Anxiety it was Pretty good exposure therapy especially, never forget that Carl Jung was /ourguy