Post your feels ahead of this epic meeting of two mega giants
I don't know who the one on the right is.
>>131258355
Why is Trump meeting with Indian Colonel Sanders?
>>131258355
Should be good. Both are populists. First meeting with Vlad is the one I most care about.
>>131258417
Both are on the right XDDDDDDD
>>131258355
who's that guy on the left?
>Trump meets face to face with his IT guy
Poo in loo! Thats what trump says to mudiman. Poo in loo! And trump refuse to shake hand with mudiman because hand is smeared with poo residue. Poo in loo in CNN headline later.
>>131258613
some american TV actor
>>131258355
Who the hell is that street-shitter on the right? I'm pretty sure he works at my 7-11
>>131258355
Will The Donald be wearing disposable gloves for the handshakes?
>>131258864
you country is going to be 95% streetshitters in the next 20 years
so you better suck up or shut the fuck up now, leaf
There is no one I hate more than Indians. So much so that I learned Hindi insults just to abuse the taxi drivers and 7-eleven workers here and if they say shit I can get them fired and probably indirectly cause them to be deported to India. Fucking bhenchods.
Bhenchod daaru mein dum hai, yaar
>>131258355
President Supreme Emperor Burger meets Mr. Pooindaloo himself.
>>131259035
>Bhenchod daaru mein dum hai, yaar
that's not a fucking insult you dumb ausnigger lmao
>>131259112
Yes it is. I was told by an Indian that it is. I use it all the time.
>>131258355
Street shitter-in-chief
>>131258417
Narendra Modi,the prime minister of India
>>131259112
Be careful pajeet, for it seems you are currently in the process of being Aussie'd. A truly gruesome internet fate awaits you.
>>13125886
>I'm pretty sure he works at my 7-11
He works a different shift than you?
>>131259147
literally laughing out loud at this
you are either an overseas pajeet fucking with me or just an idiot who got tricked by pajeets into making himself look dumb
>>131258968
How are you street shitters going to afford the $3,000,000 average house price in Canada? There aren't enough gas stations to employ you all
>>131259280
No my friend told me it, used to work with an Indian legit called Elvis who told me that.
The Mart Sharter President meets the Street Shitter Leader. Where will the toilets be?
>>131258355
Modi is a caste supporting, brown people hating racist, nationalist, anti Muslim bigot, that wants to make his country great again.
I highly doubt he and Trump will like each other.
>>131259239
Thankfully it's cold enough in Canada that the liquid diarrhea your people produce will solidify and be easy to clean off the street
Madarchod lassi mein bhang nahi hai yaar
>>131258355
Will the guy on the right POO IN LOO when he meets Trump?
>>131259291
be afraid, be very afraid you leafcuck witeboi
>>131259364
>Where will the toilets be?
Not in your favela
>Select all images with helicopters
>>131259291
>There aren't enough gas stations to employ you all
I'm sure there are still plenty of donut shops and dry cleaners for them to take over.
>>131259175
Is their Poo Minister democratically elected? Do people cast their votes using turds?
>>131259532
What a lame comeback. Burgers are truly the worst when it comes to banter.
>>131259364
>Brazil
Enough said.
>>131258817
at least you have humor
>>131259291
AHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHA
press F to pay respects to Canacucknada whiteness
>>131259492
I'm not. No sane white woman would ever date a man who is covered in his own feces
>>131258355
>Post your feels
What are you, fucking 12?
>>131259579
Slow down monkey; that's no burger. It's a kekistani in it's natural habitat. Trust me, I'm an expert hunter. After all, I'm a burger.
>>131259175
Literally who?
This is Western toilet habits.
>>131259675
>implying Indian IT nerds are interested in dating
top lel
expect them to bring their dependent brown wives with them you stupid fucker HAHAHAHAHAHAHAHAHAH
Just because there are always a few slowpokes in each thread who ask what the fuck...
Poo To The Loo is a real campaign, it exists independantly of any and all internet memes, UNICEF created it.
In India, people shit in the streets and wherever, their government had programs to bring indoor plumbing to places in India without it, but they prefer to shit outside in the street.
This is not a joke, this is real, hundreds of millions millions of Indians are literally less sophisticated in their scat management then many other kinds of mammals that at least bury their waste...and it falls to foreigners to try to teach them how to not fill their streets with their own shit.
http://unicef.in/PressReleases/13/Take-Poo-to-the-Loo-the-New-Youth-Mantra-against-open-defecation-has-people-marching-to-the-tune-of-India-s-First-Poo-Song
https://www.youtube.com/watch?v=_peUxE_BKcU [Embed]
>>131259675
>implying that indians date
Prepare for the busses of rape
It is the beginning of an interesting day.
https://www.youtube.com/watch?v=eZ2PtEx9-ls
I sincerely hope POTUS is in his plane right now shitposting on /pol/ in some thread.
>>131259766
>>131259741
I love you pajeets cause you learn so fucking fast. A week ago, you would respond to "poo in loo", and now you're trolling like fucking Trudeau himself.
Drumpf is obese enough now he's picking up KFC from colonel sanders?
>>131259741
>implying Indian IT nerds are interested in dating
Yeah, I guess you don't need to "date" when you just go straight to rape
>>131259830
good for you
that knowledge is going to help you when canada turns into Pajeetland 2.0
>mfw it is already Punjab 2.0
>>131259830
So you think Canadians are super advanced because you have a designated shitting room in your house where you sit down and push against your own body (squatting is the natural position) to try to force shit out into a porcelain bowl and use water to flush it away and then use dry paper to smear shit around your hole?
>>131259830
In Canada, they import Indians because that raises the IQ of the Canadian populace.
>tfw leaf can't even say I'm wrong
>>131259492
Even leafs arent afraid of poos. You pseudo niggers dont frighten anyone
>>131258355
superpower duo 2030
>>131259830
>One poop at a time
Sorry, poos I don't want to laugh, but just. Just.
>>131259942
Hold up muhfugga. Everybody knows only the sikhs like the Canadian cold, civilized Indians move to the New York area, or if they're feeling uppity, Frisco. Even the Pajeet grandmas know "my son moved to Canada" isn't shit compared to "my son moved to USA".
>>131258355
even india is going to embarrass america
>>131259991
>potato niggers @ing me
AHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHHAAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHHAAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHHAAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHHAAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHHAAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHHAAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHHASNKFAMSAKLFWMAVNVANPRWFPAAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHHA
>>131259945
A for effort, but never try to defend street shitting. The correct response is to deflect, e.g. Those are the muslims.
>>131259908
Ty burger
Too many triggerfags in our country, ez to meme
>>131259991
>potato nigger
>still cucked by Queen Lizzy
>"EU"
Don't you belong in some cuck thread like PTG?
>>131260178
Don't tell anybody but I'm just a poo in burger clothes :DDDDDDDDDDD Bahubali for life!
>>131258355
>Trump shows up at India
>has his security tackle and hold down Pranab
>doctors come out, sterilizing the poo in the loo's hand due to the fecal matter
>Pranab struggles to get up, tries to give Trump a dirty look but his eyes go down to the floor
>Trump winks at Pranab
>Trump says "so where is the missus so I can Mukherjee?"
>Pranab is literally shaking but can't keep eye contact
>his eyes watering, microbes of shit even polluting that water source
>"Y-you too" is all Pranab can muster
>out comes a U.S. audience, part of Trump's entourage to India
>they act as a laugh track
>"So, in this country we just shit anywhere right? I remember watching it on National Geographic" Trump says as a matter of fact
>Pranab tries to stop Trump from unbuckling his belt
>Secret Service tackles Pranab again and his guards
>the audience laughs louder
>"Sorry Pranab, but in America we shit on our own thrones" Trump says with a smirk, squatting over the royal throne
>Trump takes a beautiful Dairy Queen curled shit as Pranab looks on, crying brown tears under the secret service agents which are squeezing the poo from him
>audience all squats, shitting on the royal carpets
>Trump finishes with a squeaker of a fart, saying "Looks like something crossed the border"
>audience stands and applauds, shitting everywhere
>>131260363
I didn't even watch that shit, too over-rated.... Might be good but the constant normie meme 'why did kattapa kill bahubali' made me cringe even more
>>131260103
Trump is going to slashkill Indian outsource, IT jobs and immigration caps
he already increased the skilled labor wage threshold to something like 8 million INR per year which is much more than any average pajeet IT worker can hope to achieve. they are also cracking down on "GET INTO AMREEKA EZ"-type business and their sort
trudeau's progressive canada has already overtaken US and UK as the number 1 destination for pajeets wanting to go abroad
we all know what happens after that. pretty soon leafs will be finding themselves celebrating diwali and guru POOrnima
>>131259945
>So you think Canadians are super advanced
Not just Canadians. Pretty much every other human being on the planet at any point in human history (and likely most of our ancestors for millions of years), and also Armadillos, most types of Felines, some types of Weasels, some Foxes and sometimes Woodchucks all deal with their poo rather then just mindlessly soiling the ground in their territory.
>>131258417
>I don't know who the one on the right is.
That my friend, is the Muslim Exterminator, Kebab Roaster Narendra Modi, PM of India
>>131260567
Honestly, I thought it was a good movie. But I'm in Burgerland so they were pushing wonder woman, not bahubali. Never even heard of that stupid meme shit til I was watching songs on Youtube; that's doing the movie injustice. If you come at it expecting a modern ramayana, your expectations will be roughly met; that's what I loved about it. It's just nice knowing the values of dharma are still alive.
>>131260478
did you just google indian president before shitposting? American education at its finest.
>>131260728
nigga what?
bahubali is the shittest most overhyped movie to come out of India in over a decade
it's fans are negro-tier south indians
>WE WUZ SPECIAL FX N SHIET
thanks but no thanks
>>131260598
You're forgetting about us, pajeet. We Indian Americans aren't just gonna up and turn white; and we also happen to be the #1 income group in both countries. It's gonna be jews vs poos in Canada and the USA shortly. Our only weakness is that us pajeets hate each other more than jews, we'll have to get over caste and state boundaries and realize the #1 enemy is the jew, only then will we truly inherit the aryan bloodline and succeed where our brothers failed.
>>131260667
Kebab Fryer*. In pig lard, of course.
>>131260824
Somebody hasn't see wonder woman or the black panther trailer.
post yfw you realise that India's secret plan is to outnumber all of you, take your white women as slaves, and the niggers as slaves, and kill everybody else as pajeets take over the world with mathematical and scientific intelligence, one poop at a time.
>>131260824
Also fuck you Rajesh, just because it doesn't have a sacred khan in it doesn't make it bad. K3G had just as much hype to deliver the same fucking plot as 3000 other bollywood movies; ya'll are just jelly Tollywood made a better film than you poos could. Fucking faggots.
>>131260973
Whyte ppl BTFO! How will they even recover?!
>>131260973
What about race-traitor pajeets with a halfie kid and his sister? Asking for a friend. The race my dad traitored with is white by the way.
>>131260973
>>131261116
You guys need to fix your problems with Pakistan. Religion should not make you enemies with your kinsman.
>>131260913
>Indian Americans
ugh, disgusting.
you may be rich but you're irrelevant as fuck. you have got no influence, it took THIS LONG to get 1 whitewashed bitch into the senate. I'm sorry but I have exactly ZERO expectations from you fake pajeets.
>>131261181
True, just exterminate the Muslims, eradicate their shit tier religion and be at peace.
>>131261181
>raid.jpeg
>"fix" Pakistan
We tried but they resist being neutered.
>kinsman
We're street-shitters, not roaches. Show some fucking respect.
To the poos ITT, how is Modi?
From the little info we get here he seems rather good, but how is it perceived in India?
>>131261098
>>131260956
>this assmad ameripajeet Stewart Singh Balwidnder
HAHAHAHAHAHAHAHAHHAHAHAHAHHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHHAHAHAHAHHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHHAHAHAHAHHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHHAHAHAHAHHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHHAHAHAHAHHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHHAHAHAHAHHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHHAHAHAHAHHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHHAHAHAHAHHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHHAHAHAHAHHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHHAHAHAHAHHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHHAHAHAHAHHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHHAHAHAHAHHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHHAHAHAHAHHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHHAHAHAHAHHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHHAHAHAHAHHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHHAHAHAHAHHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHHAHAHAHAHHAHAHAHAHAHAHAHA
go back to your dhaba or your convenience store, nigger. let the real big boys talk.
>>131260913
Lower Castes don't have an Aryan bloodline you dumb cuck. The only reason we do so well abroad is because a majority of indian immigrants are highly educated UCs. Lower Castes have nigger tier IQs. We should thank our ancestors' souls that they had the sense to create the caste system otherwise we would've all been IQ 85 mixed Dalitoid sub-humans.
>>131259175
>falling for shit-tier "i was pretending to be a moron" bait
ISHYGDDT
>THREAD OVERLOADED WITH POO IN LOOS
ABANDON THREAD
>>131261205
Bro, (you) gotta give me time. It's only just starting to become normalized to be a pajeet in the USA, then we have to go and distiguish ourselves from new money pajeets because you have to be old money to be in US politics. I literally just graduated law school so it's gonna be a while before I can pull off a mad win; but I have my local free mason chapter on my side and have a side bitcoin mining business that the local mexicans have been investing in and they trust me too. The Kshatriya dharma is strong in me.
>>131261181
Akhand Bharat when?
>>131261154
Pajeets don't mind diversity, so everybody is welcome to live under their rule. As every single white boi that can think is here wasting time on /pol/, pajeets are taking over the top level positions in all of their major corporations. The 50th president of the USA will probably be a pajeet.
As far as Canada goes, the nation is just one HUGE toilet for pajeets, and the leafs just love getting pajeet poop on them as they welcome everybody with their BE LIBERAL REEEEEEEE bullshit.
You know liberalism will help Islam spread? Kek no. They're extremists, they'll die out like extremists always do. Pajeets, on the other hand, will slowly seep into every corner of the world till everybody is at least partly brown. Pajeets will beat the jews at their own game.
tfw street shitters turn out to be the superior race
>>131261338
pro-business pro-development Hindu nationalist. 90% of the majority love him.
muslims and leftists hate him because got off scotfree for massacring them in 2003. he is based.
>>131261399
I do. But I have a duty as such to protect both a home for my sons and my society.
>>131261351
What exactly do you think you're laughing at? Never forget, I shape the opinion of not only you, but your sons and your sons sons in the eyes of Americans, the locus of power in today's society, and with that power I can specifically seek to target and fuck (YOU) over.
>>131261440
ew, no
I don't want those disgusting goatfuckers in my country. Let them starve to death in their little shithole
>>131261507
Yes I heard about the 'incident' where he allowed a religious tumult to happen with 2000 goat rapers dying.
Keep up the good work then, superpoower by 2030.
>>131261478
Yep. But I don't want to just re-make India; I want to form a new AnCap-style government. Funnily enough, Indians are really good at governing themselves because of the rampant corruption, and so are able to get things done. Combined with a mixture of avant-garde Western multi-kulti and some good old chink collectivist labor, I'm pretty sure we could engineer the ultimate society.
FYI most pajeets are uncircumcised. Pity the poor women who have to blow/suck uncut indian cock.
Little wonder that almost all escort/prostitute ads say clearly "No indians!"
>>131261576
>I shape the opinion of not only you, but your sons and your sons sons in the eyes of Americans
top kek you beta faggot, do you think real Indians care what anyone thinks about them?
Saudis and Emiratis torture Indian workers, that doesn't stop them from going there in record numbers every year. Do you REALLY think REAL Indians care about some hillbilly burger's opinions?
Indians will keep flooding in as long as there is jobs and money. you can act like a monkey as much as you want to "influence American opinions" but it is irrelevant.
>>131261800
It makes the difference whether or not you'll be held in esteem in American society, but I guess a low caste shitskin like you wouldn't understand such realpolitik. You're free to go now, pajeet; your services are no longer required.
>>131261800
And the difference you'll always seek to acquire but never really understand is what it means to be both burger and pajeet.
>>131260478
Nigga that ain't even Pranab you cuck
>>131261756
Agreed.
>mfw some people named a village in Haryana as Trump village.
>>131261623
>low caste
>shitskin
>pajeet
>"YUO'LL NEVER BE AMERICN LOLS"
>so mad he replied to me twice
I can literally feel you shaking and crying like a little girl from here lmao
>realpolitik
>implying a dumbass like you can understand the word while we out here watching and experiencing the effects ultrarealpolitk every single day
KEK
E
K
>>131262219
But we still have to build it on huge stone elephants mounted in the ocean with magnificent waterfalls and theatrics; and we have to celebrate diwali. For old time's sake.
>>131262484
Pajeet, put down the desi daru and quote the correct post.
>>131262484
meant for >>131262013 >>131262090 this little bitchass deluded pajeet
>>131262484
confirmed low-caste shitskin pajeet
>You'll never be American
What I meant was, you'll never be civilized.
>ultrarealpolitik
It's sad when niggers try to be people. Yes, I'm sorry, but you are the nigger of Indian society. And you weren't given the opportunities to learn that realpolitik is a Germanic-derived phrase for the politics derived from the practical, i.e. the cool pajeet I met in Texas said don't trust pajeets from India, they're sketchy street-shitting low-caste fucks. Especially beware of that hideous accent, the eternal curse on pajeets to prevent them from assimilating.
>Understand the world
Try me, Hari.
What's going on in here?
>>131262373
Haryanvis are too based
>>131263095
Crawl back under the sink, ahmed.
>>131259353
"Bhenchod daaru mein dum hai, yaar"
That literally means there is life/spirit/power in alcohol
>>131263603
Craawwwwwwwling in my skinnnnnn.
>>131263983
Please tell how are Pakistanis doing in Australia. Are they the same as Pajeets? Violent, Sexually frustrated, frauds, scammers, perverted, unhygenic, rude. Right?
>>131262885
it's sad when pajeets try to act higher-than-thou while being painfully unaware of their own stupidity
>blabbering about realpolitik
yes, you dumb nigger. did you learn that word yesterday on r*ddit? we experience realpolitk on different level compared to the west. let me enlighten your illiterate peabrain.
>modi's party is pro-development, but he bans banknotes which causes a slowdown and a huge portion of his supporters to get angry. but he also bankrupts his opponents in the upcoming UP election who were hoarding cash to influence voting and sweeps the state
>modi has a chance to indict and arrest the opposition's key figures on past corruption charges but he spares them on the basis of a verbal promise of them doing the same to him if something happens and he is not in power
>modi defies the pro-small business organization RSS which controls his party, to deregulate and introduce foreign investment in nearly every sector. this helps him gain support of industrialists and the rich.
>our state governments make deals with separatists and communist guerrillas in order for business projects to stay safe
this is what realpolitk is, you dumb dalit. not your little chats with pajeet IT workers.
now do the world a favour and hang yourself
>>131264110
>it's sad when pajeets try to act higher-than-thou while being painfully unaware of their own stupidity
Same mentality we Pakistanis have. We're too deluded in our sheer stupidity. Ignoring our flaws and social status in this world.
>>131264110
So basically, Modi is a fucking kike puppet?
>>131258562
Nice
>>131258355
POO
The poo fears pic related.
>>131258355
are they really meeting pajeet and if they are for what reason?
>>131259035
>Daaru mein dum hai, yaar
Dude wtf u just got trolled by some indian there
Its not even an insult kangaroo....
>>131259415
>Brown people hating racist
How???
>>131259447
Again that doesn't mean anything ...u got trolled by some nri...
>>131264744
God save the queen.
Haha so many of you trying to insult indians by saying poo in the loo
You guys do realise that there are less than 20indians itt...and all of the indians here are rich enuf to afford a toilet
We dnt shit in the streets...
If u really wanna insult indians then go ahead and tweeet it to these guys..
@pmoindia -pm of india
@nstomar - he is responsible for sanitation
Indian twitter is crazy and they get triggered easily
Go ahead lets see what you can do