Were they good parents?

Yes, they love Calvin and didn't raise up his unrealistic standards for stuff. The only time they get mad at him is when he's being a typical shit head 6 year old.

File: calvin dad story.gif (137KB, 600x427px) Image search: [Google]

137KB, 600x427px

>>94279138
watterson was alwys clear that we only ever saw a portion of the full lives of calvin's family and that he just chose to highlight the funny and poignant parts, rather than show the enitrety of it like most bad family comics. I think it worked to the comic's benefit

File: calvin-and-hobbes-dinosaurs.gif (34KB, 600x195px) Image search: [Google]

34KB, 600x195px

>>94279138

fuck it Calvin and Hobbes thread

File: C&H_Trains,_Planes,_'n'_Tectonic_Plates.jpg (738KB, 2489x1731px) Image search: [Google]

738KB, 2489x1731px

>>94279138

File: do-you-want-to-build-a-snowman.jpg (110KB, 562x722px) Image search: [Google]

110KB, 562x722px

>>94279138

Yes. they loved him and he loved them.

File: calvin dad story 2.jpg (195KB, 800x1021px) Image search: [Google]

195KB, 800x1021px

>>94279214

another of my favorite calvin's dad stories

File: bill5.gif (68KB, 600x425px) Image search: [Google]

68KB, 600x425px

>>94279138

>>94279302
Don't tear up often, but this one got me. Wish I had this kinda childhood.

File: calvinalienpoem.gif (176KB, 800x557px) Image search: [Google]

176KB, 800x557px

>>94279414

>>94279356
I don't recall ever seeing this one.

File: calvin_kazam.jpg (4MB, 2164x1485px) Image search: [Google]

4MB, 2164x1485px

>>94279424

learning the lesson is whats important, not necessarily having calvin's kind of childhood. And it's never too late to learn the lesson.

>>94279138
God I love Calvin & Hobbes.

File: calvin454.gif (169KB, 800x556px) Image search: [Google]

169KB, 800x556px

>>94279475

glad to be able to introduce it to you

>>94279138
they were very realistic for comic strip parents

File: calvin-and-hobbes-meaning-of-life.jpg (458KB, 1600x1178px) Image search: [Google]

458KB, 1600x1178px

>>94279513

without a doubt, it's one of the greatest works of art in the 20th century.

File: calvinandhobbes_ee16a29bdee49968c5835be98ae23949.jpg (308KB, 1200x837px) Image search: [Google]

308KB, 1200x837px

>>94279533

that they were.

File: calvinandhobbes_c4ede94edbe351f0be58a725ff745f89.jpg (312KB, 1200x829px) Image search: [Google]

312KB, 1200x829px

>>94279618

File: 198534264.jpg (46KB, 472x579px) Image search: [Google]

46KB, 472x579px

>>94279138
what did he mean by this?

File: calvinbothsides.gif (64KB, 600x421px) Image search: [Google]

64KB, 600x421px

>>94279644

I meant to say that I love the expression of the airline passenger in the upper right panel

File: Calvin & Hobbes Touchdown.jpg (297KB, 1498x1152px) Image search: [Google]

297KB, 1498x1152px

>>94279675

File: calvinandhobbeswinter-1.png (91KB, 879x620px) Image search: [Google]

91KB, 879x620px

>>94279714

File: hail hydra 01.jpg (96KB, 986x553px) Image search: [Google]

96KB, 986x553px

>>94279560

File: calvin-and-hobbes.jpg (152KB, 640x446px) Image search: [Google]

152KB, 640x446px

>>94279733

>>94279138
No. They don't strike him enough. That's why he's such a horrible child.

File: calvin_violence.jpg (408KB, 1600x1175px) Image search: [Google]

408KB, 1600x1175px

>>94279784

File: 19920719.gif (83KB, 600x419px) Image search: [Google]

83KB, 600x419px

>>94279819

File: calvin-and-hobbes-HD-Wallpapers.jpg (497KB, 1680x1050px) Image search: [Google]

497KB, 1680x1050px

>>94279846

File: calvindeergun.gif (165KB, 800x550px) Image search: [Google]

165KB, 800x550px

>>94279859

File: calvinfly.jpg (305KB, 1200x832px) Image search: [Google]

305KB, 1200x832px

>>94279881

I have The Indispensable and The Wonderful World. What am I missing?

File: calvin-hobbes-bee-sting-drama-queen.png (408KB, 600x421px) Image search: [Google]

408KB, 600x421px

>>94279899

File: calvinmonologuefood.jpg (231KB, 1274x1000px) Image search: [Google]

231KB, 1274x1000px

>>94279901

The Tenth Anniversay book is vital, the detail watterson writes about his take on comics/comic history and art as well as his musings on the characters in his strips is really illuminating.

File: calvintrexpoem.jpg (378KB, 990x689px) Image search: [Google]

378KB, 990x689px

>>94279972
>>94279901

I kinda muddled up what tried to write but regardless, my point is that the Tenth Anniversary book is the best.

File: calvin-and-hobbes-survive-a-deadly-hill.jpg (321KB, 1860x1050px) Image search: [Google]

321KB, 1860x1050px

>>94280011

File: ch_wildzontars.gif (100KB, 600x422px) Image search: [Google]

100KB, 600x422px

>>94280032

it's time for some spiff

File: calvinspiffearly.png (1MB, 1095x794px) Image search: [Google]

1MB, 1095x794px

>>94280049

File: calvin spiff lesson.jpg (436KB, 772x533px) Image search: [Google]

436KB, 772x533px

>>94280077

File: xzlpn.jpg (384KB, 1634x1164px) Image search: [Google]

384KB, 1634x1164px

Without a doubt one of the best two-panel starts to a strip ever.

File: spiff4.jpg (141KB, 640x788px) Image search: [Google]

141KB, 640x788px

>>94280099

dubs

File: calvinhistoryiswhatsimportanttome.jpg (91KB, 800x1022px) Image search: [Google]

91KB, 800x1022px

>>94280158

Thanks for helping out. keep posting.

are there any lurkers about?

File: calvinalienab.jpg (299KB, 900x632px) Image search: [Google]

299KB, 900x632px

>>94280197

I gotta go but i'll be back in a few hours.

>>94279846
This one I like

File: calvindadf3053ef01b8d1f5a2c7970c-800wi.png (696KB, 800x561px) Image search: [Google]

696KB, 800x561px

>>94280218
Watterson was great at visual storytelling.

These strips have zero dialogue, yet you can tell exactly everything that's happening. I don't think there are any strips running in the papers nowadays that are capable of doing this anywhere near as well.

This one's one of my favorite Calvin's dad strips.

File: useless information.jpg (70KB, 736x230px) Image search: [Google]

70KB, 736x230px

For me, this particular strip hits really close to home.

Bump.
I read these back when I was a kid, and I found them funny.

Now I realize what a masterpiece they are.

>>94279733
>Final shot is in the same generic frame that 95% of newspaper comics use

Watterson was a genius

File: calvin and hobbes09u43.gif (49KB, 600x415px) Image search: [Google]

49KB, 600x415px

This comic really depresses me as an adult. I used to think it was funny

>>94279675

This legitimately is a great explainer of cubism

File: calvin-hobbes-low-self-esteem-and-immediate-gratification.png (36KB, 600x189px) Image search: [Google]

36KB, 600x189px

Who is in the right here?

>>94281841
He knew.

>>94280197
>>94280218

I'm lurking
Thanks for posting these.

>>94282040
Odd that Calvin's generation (early 80s kids) were not the ones who you'd blame for that sort of thing, isn't it?

>>94281841
This is too goddamn prophetic.

Calvin is the original Millennial.

File: 1404154007958.gif (2MB, 320x200px) Image search: [Google]

2MB, 320x200px

>>94279138
I honestly don't think I've ever laughed harder in my entire life then when I read the Transmographier sequence. I must have been down for twenty minutes. I think I almost passed out.

>>94280197
I am, thanks for the memorys anon

>>94280197
>>94280197
me. ur doing gods work

File: 1501349240921.png (76KB, 458x338px) Image search: [Google]

76KB, 458x338px

>expect thread full of millenials saying Calvin's dad sucks for getting angry over broken binoculars because their parents were completely useless in instilling discipline in their worthless spawn
>instead it's just a Calvin dump

Thanks for curbing your autism guys

File: Calvin and Hobbes-2007.05.20.gif (79KB, 600x431px) Image search: [Google]

79KB, 600x431px

>>94283402
>>94282054
>>94281620
>>94281555


thanks everyone, Glad to see the thread's still going. I'm gonna keep posting!

File: Calvinball1.gif (542KB, 1600x1125px) Image search: [Google]

542KB, 1600x1125px

>>94283613
time for some calvin ball

>>94283540
No prob.

File: Calvinball 5-27-90.jpg (406KB, 1600x1236px) Image search: [Google]

406KB, 1600x1236px

>>94283648

File: ch890129.jpg (85KB, 800x1035px) Image search: [Google]

85KB, 800x1035px

>>94283682

>>94279282
God damn that's a good punchline.

File: CH860525.jpg (89KB, 600x421px) Image search: [Google]

89KB, 600x421px

>>94283738

it's one of my faves

File: chmonopoly.jpg (66KB, 550x694px) Image search: [Google]

66KB, 550x694px

>>94283806

File: Calvinhighculture.jpg (78KB, 650x442px) Image search: [Google]

78KB, 650x442px

>>94283830

File: calvin-and-hobbes-summer-vacation-1.jpg (2MB, 3281x2281px) Image search: [Google]

2MB, 3281x2281px

>>94283867

File: calvin flying car.jpg (114KB, 736x534px) Image search: [Google]

114KB, 736x534px

>>94283921

File: calvin_hobbes_trex_jet.jpg (299KB, 800x553px) Image search: [Google]

299KB, 800x553px

>>94283966

this is one of the best ever

>>94279846
Can I just ask a question as an educator? This is purely from an American viewpoint.

While I get that sticking a child in a classroom and expecting them to be a worker bee stifles their imagination and creativity, which is only exacerbated in middle and high school where other students pressure each other into not giving a shit, at the same time people are currently graduating college with STEM degrees without being able to perform simple mathematics. I've seen professors ban the use of calculators in basic algebra classes with test scores plummeting as a result.

Where's the middle line between exploring personal creativity and teaching essential skills?

File: calvinifigetapresent.gif (79KB, 600x422px) Image search: [Google]

79KB, 600x422px

>>94283996

>>94283867
I remember trying to make snow sculptures like Calvin when I was a kid but they never worked out well.

File: calvinschooljet.gif (81KB, 600x423px) Image search: [Google]

81KB, 600x423px

>>94284007

i think it's important to differentiate between calvin's perspective and watterson's. watters wrote that he always had sympathy for wormwood and she was never portrayed as a bad teacher so I don't necessarily think that calvin and hobbes was ever arguing against the education system itself. instead it was giving voice to the kids who existed within it.

like in this comic here, watterson said he got a lot of hate mail for it, but it was as if adults had forgotten what it"s like to be a kid. He's not adovcating this actually happening he's just showing the desires of kids in an entertaining and novel way

File: Typical School Day.gif (65KB, 600x416px) Image search: [Google]

65KB, 600x416px

>>94284131
>>94284007

and to continue my point, wattersonsaid of this strip

" if calvin thinks school is this bad wait until he gets his first job"

>>94284069

there have definetly been some good ones irl but yeah it's hard.

File: Calvin-and-Hobbes snowreal.gif (144KB, 468x446px) Image search: [Google]

144KB, 468x446px

>>94284195
>>94284069
oops forgot pic

File: calvinsnowballmorality.gif (65KB, 600x415px) Image search: [Google]

65KB, 600x415px

>>94284221

File: Calvin---Hobbes-calvin--26-hobbes-116944_1024_768.jpg (261KB, 1024x768px) Image search: [Google]

261KB, 1024x768px

>>94284259

>>94284007
Buddy, that is way too intelligent of a question for 4chan. You'd be better off taking that to your school administrators or your local board of education.

Still, if you want a completely worthless and uneducated opinion, I'll gladly offer mine. I think the line is when the students get enough individual attention to compensate for their differences in learning. Ideally, teachers should have the time to tweak lessons to suit kids with different styles of learning. That way you can teach them the essentials in a way that doesn't stifle their development.

>>94284195
>>94284221
Those are great.

File: Calvinbikesunday.jpg (355KB, 1600x1140px) Image search: [Google]

355KB, 1600x1140px

>>94284289

File: ch01.jpg (221KB, 900x617px) Image search: [Google]

221KB, 900x617px

>>94284319

File: calvin and hobbes christamas poem.jpg (168KB, 736x944px) Image search: [Google]

168KB, 736x944px

>>94284360

now for a series of poems

File: calvinalienpoem.jpg (599KB, 900x625px) Image search: [Google]

599KB, 900x625px

>>94284414

File: calvinufopoem.gif (56KB, 600x423px) Image search: [Google]

56KB, 600x423px

>>94284444

File: calvin santa poem.jpg (207KB, 900x632px) Image search: [Google]

207KB, 900x632px

>>94284475

File: watterson.jpg (25KB, 260x320px) Image search: [Google]

25KB, 260x320px

Has there been a picture of Bill Watterson made in the 2000s?

This guy is so elusive, he's like bigfoot.

These comics always do a great job of making me want to be a kid again.

File: calvin nauseous nocturne 1.jpg (393KB, 944x623px) Image search: [Google]

393KB, 944x623px

>>94284537

Not that I know of, there was a documentary made about him and he has actually drawn a poster for a comics festival ( and a few strips actually)

Now ,though for "a nauseous nocturne"

File: calvin nauseous nocturne 2.jpg (373KB, 959x625px) Image search: [Google]

373KB, 959x625px

>>94284678

part 2

This thread makes me want to give my collection another full read through. Last time was probably when I was 14, going through as a 21 year old will probably effect me very differently...

File: calvin nauseous nocturne 3.jpg (215KB, 918x611px) Image search: [Google]

215KB, 918x611px

>>94284707

part 3

File: calvin nauseous nocturne 4.jpg (424KB, 962x625px) Image search: [Google]

424KB, 962x625px

>>94284720
I recommend it, it's truly timeless and worth rereading.

File: calvin nauseous nocturne 5.jpg (333KB, 957x616px) Image search: [Google]

333KB, 957x616px

>>94284779

part 5

File: calvin nauseous nocturne 6.jpg (345KB, 964x622px) Image search: [Google]

345KB, 964x622px

>>94284803

File: calvin_ethics.jpg (202KB, 1112x1093px) Image search: [Google]

202KB, 1112x1093px

>>94284831

I feel this one applies to a lot of 4chan

File: calvindefiant.jpg (315KB, 900x623px) Image search: [Google]

315KB, 900x623px

>>94284906

File: calvingetsana.gif (67KB, 600x419px) Image search: [Google]

67KB, 600x419px

>>94284940

>>94279424

Make sure your kids have one instead.

>>94284007
Let kids choose what they want to do. I mean make sure they get the essentials in grade and middle school, but by the time they hit high school we should be doing that Swedish thing where it's basically mini college and you just take electives with a few core classes until you graduate...

>>94279383
Hobbles you dog.

>>94279214
I do the same thing.

File: calvinsummernothing.jpg (116KB, 700x901px) Image search: [Google]

116KB, 700x901px

>>94284977

this is where I'm at in life right now.

File: calvintrexsandwhich.gif (114KB, 600x417px) Image search: [Google]

114KB, 600x417px

>>94285048

File: calvin90'scomputerjoke.png (897KB, 880x608px) Image search: [Google]

897KB, 880x608px

>>94285098

this is probably the most dated joke in all of calvin and hobbes even though it still works

File: calvincrudedrawing.png (559KB, 576x398px) Image search: [Google]

559KB, 576x398px

>>94285130

File: calvinparentssuperheros.jpg (260KB, 900x624px) Image search: [Google]

260KB, 900x624px

>>94285164

>>94285130
computer problems are timeless

>>94279675
>when you misaligned your QPU

>>94279302
Ohh that's a nice one.

>>94284007
The biggest problem I see is that currently, nobody flunks school.

I work for the Long Beach school district in CA, assessing students for entry into special ed. classes and at-risk students. Everyone, and I mean everyone, graduates from high school. I've seen drooling retards go up on stage and get their high school diploma.

I feel strongly that everyone should have the opportunity to go through public school, but not everyone should graduate. Life is tough, why should our schools suddenly be a safe haven for feelings?

File: calvini'llgiveyousomethingtotalkabout.png (75KB, 600x419px) Image search: [Google]

75KB, 600x419px

>>94285190

File: calvinfightingschoolbus.gif (102KB, 759x526px) Image search: [Google]

102KB, 759x526px

>>94285397

File: calvinhobbes_sapghetti.gif (84KB, 600x426px) Image search: [Google]

84KB, 600x426px

>>94285429

File: calvingrosssunday.jpg (259KB, 900x626px) Image search: [Google]

259KB, 900x626px

>>94285467

File: calvintrexsnowmen.jpg (63KB, 600x425px) Image search: [Google]

63KB, 600x425px

>>94285496

>>94279138
in some commentary he actually made the parents more "human" and showed their exasperated side more often and it made them appear callous to some, especially when compared to the sanitized versions of parents shown back in the day

he notes that calvins parents seem like saints in comparison to some later examples of bad parents who would later appear on TV

File: calvinfakeenthusiasm.jpg (97KB, 736x534px) Image search: [Google]

97KB, 736x534px

>>94285523

>>94285496
So Hobbes is how Calvin compartmentalizes all the parts of himself he isn't comfortable with or what?

File: calvincapitalism.png (1MB, 1165x835px) Image search: [Google]

1MB, 1165x835px

>>94285552

>>94285593
Hobbes is a tiger.

File: calvinhobbeswaiting.png (86KB, 600x415px) Image search: [Google]

86KB, 600x415px

>>94285593

If only watterson was cool with making a calvin and hobbes animated series. following the comics. I used to read this in elementary school. one day I picked it up in 4th grade and I immediately fell in love with it. Years later, I find it refreshing that I understand the jokes more completely.

File: calvinfuniswork.gif (96KB, 600x424px) Image search: [Google]

96KB, 600x424px

>>94285646

>>94285679
He hates commercialism too much for that to have ever happened.

File: calvinwater.gif (75KB, 600x423px) Image search: [Google]

75KB, 600x423px

>>94285700

>>94285679
I'm glad he didn't do anything else besides comics with Calvin. It's the only thing "pure" we have left.

>>94279424
when you have kids have at it anon. I believe in you.

File: calvinspiffshoes.jpg (145KB, 640x822px) Image search: [Google]

145KB, 640x822px

>>94285728

File: calinvgreetingsmynameiskalfan.gif (119KB, 800x551px) Image search: [Google]

119KB, 800x551px

>>94285758

File: calvinclassicspiff.gif (96KB, 600x422px) Image search: [Google]

96KB, 600x422px

>>94285807

File: calvinspiffdinosaur.gif (112KB, 600x416px) Image search: [Google]

112KB, 600x416px

>>94285843

File: calvinbedpull.gif (172KB, 800x559px) Image search: [Google]

172KB, 800x559px

>>94285879

File: calvinspiffdisaster.jpg (123KB, 600x764px) Image search: [Google]

123KB, 600x764px

>>94285908

File: calvin-fathers-day-present.jpg (2MB, 1668x1176px) Image search: [Google]

2MB, 1668x1176px

>>94285932

File: 1458583391332.jpg (117KB, 1058x705px) Image search: [Google]

117KB, 1058x705px

>>94285946

File: calvinhobbeswisdom.jpg (210KB, 900x635px) Image search: [Google]

210KB, 900x635px

>>94285972

File: calvinhobbeslostinwoods.jpg (272KB, 900x637px) Image search: [Google]

272KB, 900x637px

>>94285998

File: calvinhobbestrappedoutside.gif (88KB, 600x428px) Image search: [Google]

88KB, 600x428px

>>94286039

File: calvinsellscar.gif (86KB, 600x423px) Image search: [Google]

86KB, 600x423px

>>94286080

>>94279138
Eh. They were ok.

>>94279138
wait, three panels? how often did watterson use three instead of 4?

File: calvinpeoplelikeanimals.png (503KB, 600x423px) Image search: [Google]

503KB, 600x423px

>>94286119

File: calvinsummerlarge.jpg (620KB, 2607x1466px) Image search: [Google]

620KB, 2607x1466px

>>94286151
watterson really dislike how limiting the standard four panel setup could be and that really drove a lot of his experimentation in his later years

File: calvinslowmotiontackle.jpg (262KB, 1200x816px) Image search: [Google]

262KB, 1200x816px

>>94286223

File: calvin and hobbes.jpg (2MB, 1988x3056px) Image search: [Google]

2MB, 1988x3056px

>>94285988

File: calvinchoices.jpg (299KB, 1138x800px) Image search: [Google]

299KB, 1138x800px

>>94286253

File: calvingreedyfall.jpg (532KB, 1600x1245px) Image search: [Google]

532KB, 1600x1245px

>>94286280

File: calvinmothersday.jpg (443KB, 1600x1227px) Image search: [Google]

443KB, 1600x1227px

>>94286319

File: calvinhspacekablooie.jpg (577KB, 1600x1142px) Image search: [Google]

577KB, 1600x1142px

>>94286358

>>94284831
>The monster in his consternation
>demonstrates defenestration
I really wish I could hug Bill Watterson right now.

File: calvinchangeisinevitable.jpg (595KB, 2643x1950px) Image search: [Google]

595KB, 2643x1950px

>>94286407

File: calvinspikecat.jpg (363KB, 1600x1155px) Image search: [Google]

363KB, 1600x1155px

>>94286440

>>94286415
Don't we all?

File: calvincubism2.jpg (241KB, 1600x523px) Image search: [Google]

241KB, 1600x523px

>>94286488

File: calvinwar.jpg (2MB, 2305x2944px) Image search: [Google]

2MB, 2305x2944px

>>94286525

File: calvinsneeze.jpg (3MB, 1532x1917px) Image search: [Google]

3MB, 1532x1917px

>>94286559

File: calvinfinal.png (466KB, 1920x1200px) Image search: [Google]

466KB, 1920x1200px

>>94286597

Thanks for sticking with me everyone but I gotta be done for the night. I hope you enjoyed it.

File: Andre.gif (2MB, 267x200px) Image search: [Google]

2MB, 267x200px

>>94286260
Don't you do this.

>>94286488
This puts a really big smile on my face.

>>94280158
>Let's Hope It's A Divorce!

gets me every time

>>94286643
Thank you, I very much enjoyed this.

>>94285946

This hurts my fucking heart.

>>94285031
*tiger

File: spiff fanart.jpg (239KB, 692x532px) Image search: [Google]

239KB, 692x532px

>>94279972
Comic strips were always a huge influence on my own work, and that's in large part to books like Tenth Anniversary Book and Pre-History of the Far Side. A lot of the Bloom County books had plenty of commentary as well. It's the reason I subject what few readers I have to behind-the-scenes stuff. It's probably largely self-indulgent, but if at least one person appreciates it, I'm happy.

I don't want to make this thread about me. Post more C&H

>>94279138
>Were they good parents?

His dad was a drug baron who had Suzie murdered, and Calvin got raped by the babysitter as a kid. So no, they weren't good parents.

Oddly enough Calvin turned out alright.

>>94286643
Thanks for posting them
See you later

>>94283540
did you forget that calvin's dad apologized for blowing up at his son?

thank you.

>>94279513
This is one of the only things I feel like /co/ can agree on

>>94284131
I enjoyed reading that strip at school and suddenly i was in trouble as if i could/would legitimately hijack a foreign fighter jet to attack the school.

File: spencer_and_locke_002_003.jpg (1MB, 1988x3056px) Image search: [Google]

1MB, 1988x3056px

>>94287186

>>94283540
good job getting your asshurt about a thing that didnt even happen just so you could make your point about "muh millenials" or whatever

>>94283806
My parents did the same thing with beer when I was 4 or 5. I never did acquire a taste for it though I did get much too into drinking whiskey.

>>94279807
Calvin got spanked at least once. It was a comic where he sprayed his mom with a water hose.

>>94285130
I can relate to this when setting up CAD software.

>>94287663
There was a Calvin and Hobbes thread a while back with some autist who kept saying Calvin's parents were abusive for shouting at him

>>94284007
When I was in elementary and middle school, I hated doing anything math related, although I showed pretty good aptitude for it. Especially when we hit algebra, I despised almost every second of math class. Then in high school when I took geometry and calculus, I fell in love with math and went to college to become an engineer. Looking back, I still hate arithmetic to some extent, and generally most of my Calculus mistakes are in small details like negative signs and whatnot. Personally, I'm glad that my school forced me to suck it up and learn math, and I'm glad that my parents made me take the advanced track of math. Just my two cents.

Also, fwiw my middle school teacher kind of sucked, while my high school geometry and calc teacher was excellent.

>>94284444
I always kind of laughed about how Calvin is silly for thinking his 'parents' want to turn him into an alien. Now I actually get it. I mean, I guess I always got it, but it never really clicked until seeing it again now.

>>94279846
I did things like this as a kid, before I got put on meds. Calvin really is an accurate depiction of ADHD.

>>94285048
>the trees being the panel borders

something so simple works so well.

>>94287663
>good job getting your asshurt
BACK
ATCHA
BUDDY

>>94287663

The last couple C&H threads I've seen have been people shitting on the strip and Watterson.

I almost didn't open the thread because I expected more of the same. Years ago Calvin and Hobbes would have been beyond reproach here. But not anymore.

>>94285733
This. Peanuts had the Christmas and other holiday specials which are classics, but now are featured in insurance commercials.

File: CHFixed.jpg (3MB, 3065x2224px) Image search: [Google]

3MB, 3065x2224px

>>94286559
The formatting of this strip really bugged me, so I fixed it back to what Watterson probably intended. The paper killed the typical 'one long with title and one short punchline' most of the strips tended to do.

He really was skilled. I mean he had to formulate strips where they could change the shape of them by moving his panels around to fit various papers and their advert placements.

>>94286260
Ok, now I really need to know how this ends.

File: PlanetSnoopyValleyFair.jpg (242KB, 940x421px) Image search: [Google]

242KB, 940x421px

>>94290214
yeah peanuts has an ungodly amount of crappy tacky merchandise from jewellery stores doing diamond snoopy earrings and brooches to crappy figurines in stationary stores and lets not forget the bizarre theme park for babies thing.

>>94284537
He's hiding with Steve Ditko

>>94285646
It's the things like panel 8 that really warm my heart

Anyone got the one where the car breaks down
>You can swear mom! We don't mind!

>>94282846
>>94282802
It only seems prophetic because people have been saying the exact same thing about "kids these days" since forever.

>>94288836
No, he's just an accurate depiction of a red-blooded American boy.

Are there any other books with Bill's commentary other than the 10th anniversary one?
I love reading the creator's thoughts in their own stuff. That's why I like the Pearls Before Swine collections.

>>94284007
>I've seen professors ban the use of calculators in basic algebra classes with test scores plummeting as a result.
what use are calculators in algebra at all?

Or is Texas Instrument calculator lobby strong enough to bend the what algebra is in America?

>>94279214
>>94279282
>>94279302
>>94279338
>>94279356
>>94279383
>>94279414
>>94279507
>reading these again
>flashing back to going to the mall to buy C&H collaboration books.
>having the nice feeling of reading each new one at the Ground Round restaurant.

I must hide this thread now.

>>94279819
How can one comic be so based?

>>94280321
this is kinda what school was like for me, I was smart, and the teachers would always end up teaching at the speed the slowest kid in class could handle so I was always ahead &/or bored out of my mind so when I was asked a question I was completely lost. Most often would happen in English or Lit classes when teachers would have every student take turns reading a page out loud, I can read really fast so I'd always be 50+ pages ahead reading to myself in my own world then get in trouble when it was my turn to read out loud and I'd go "i have no idea where we are"

>>94285679
naw, people would just bitch the voice actors weren't what they imagined and all the other stupid shit like that. be happy with the comics

File: SamoaJoeHugHold Daaaaaaawwww.gif (2MB, 360x202px) Image search: [Google]

2MB, 360x202px

>>94283682
FUCKING HELL
I started reading this comic and as soon as I got to Hobbs saying that Calvin had to sing the "I'm very sorry song" my mind instantly recalled that song almost verbatim (I forgot the line about "took you precious") without having to read the panel. Like I recalled how I used to sing the song in my head when I read that panel as a kid. I even remembered that I imagined Hobbs singing it like the bass in a barbershop quartet. The thing is, I had forgotten about this page for almost 13 years so the fact that it just sprang back into my head is fucking insane. I had mostly forgotten about how integral these comics were to my growing years and my sense of humour. But unlike say Homestar Runner, most of the stuff was just wiped from my mind over time and only reading this thread has made it all rush back to me at once. I miss these comics and I am glad they existed. Thank you anons.

>>94279784

gets me errytime

>>94295042
Man, if I ever become a parent the temptation to behave exactly like Cavlin's dad might be too powerful to resist.

>>94286407
I love that this actually gained some informal popularity in the scientific community.

File: 1501482768712.jpg (22KB, 480x910px) Image search: [Google]

22KB, 480x910px

>>94285048
>in two week you have to stop pretending to be a child living in the eternal summer and start being a lunch lady again

>>94281900
This still fucks me up. Fucking physics.

>>94292769
I mean, maybe I'm proving your point here, but I need a calculator for 9 x 7.

I never memorized my multiplication tables in 4th grade. I was the class retard when it came to math. I still count on my fingers.

File: 1497505251890.jpg (128KB, 900x900px) Image search: [Google]

128KB, 900x900px

>>94279138
The best

>>94295806
>doesn't remember the hand short cut for multiples of 9
Really? Unless that's what you meant by count

>>94295857
___DELET___

File: 1264583407496.jpg (127KB, 748x805px) Image search: [Google]

127KB, 748x805px

>>94285593
>Hobbes is attracted to Susie
>He is a part of Calvin's personality
They're gonna get married once they grow up.

>>94286643
Calvin and Hobbes was the only book I would stop to read back when I was learning, so I'll always have time for Calvin. Thanks man.

>>94295806
All of mental math (above memorization is breaking it into easier steps). 9x7 = (10x7)-(1x7)
Long multiplication is pretty terrible without paper.
10x7 is easy, 70 -7 is easy.

>>94295883
Nigga why would I lie in a Calvin and Hobbes thread.

>>94296171
maybe I'll remember it now. I do fractionals and percentages well, but multiplication I just didn't(couldn't) learn. School wasn't as arduous for me as it was for Calvin, but I still empathized heavily. Not to mention that adults(parents) feel like the enemy when you're a kid.

>>94295883
What hand shortcut? I just did the "tens is number-1, units is tens-9"

>>94297034
Using all ten of your fingers, count in which ever direction you wish what you're multiplying 9 by. Every finger before that is the unit in the tens place, every number after that is the unit in the ones place. Only works up to 10, but it blew my mind as a kid. I know there's other hand symbols that do the same. Pretty sure one of the nerd comics, xkcd or SMBC did a comic on it, but that's the only one I found out in school.

>>94294824
Some asshole (unrelated to Watterson) actually went and wrote "Hamster Huey". I seriously considered going to a book signing to spit on her.

>>94297208
>Independent female artist assaulted at a signing by deranged internet lunatic
It's not worth it anon. Did Watterson himself respond at all?

>>94297229
Watterson has effectively cut himself off from the world (at least as a public figure). The only time he did anything publicly was when he did those strips for pearls before swine.

File: 1501248394653.jpg (53KB, 604x604px) Image search: [Google]

53KB, 604x604px

>You will never cuck Calvin's dad

Why am I still alive?

>>94292924
But did you get quarters for Arkanoid and Street Fighter 2 at the Ground Round?

>>94285130
I think the most dated jokes revolve around them renting a VCR player

>>94296171
>9*7=>(10*7)-7
my dawg the trick for multiplying 9s is the tens place is one digit less and the ones place is 10-x.
Also, if a number is divisible by 9 then the sum of all digits must be divisible by 9.
> 54 -> 5+4=9
>108 -> 1+0+8=9
>747 -> 7+4+7=18
and so on

but really whatever work is fine

File: 6227681+_2ed2bd2cf58e4f4f2209220e68a1cf45.jpg (22KB, 326x215px) Image search: [Google]

22KB, 326x215px

>>94284007
We as a society float on our expectations rather than our accomplishments. More than ever, a fraction of a percent of people give exponentially more than they take from the earth and others, a third perhaps cut even or produce slightly more, and we simply write the others checks.
What would happen if the guy who stares into space, waiting for 6 customers to bother him daily at the dying outlet store, the waitress who makes $40 an hour, the non-pejorative retard who bags your groceries don't have a high school diploma? Intrinsically nothing, but we expect people to have one.
Except blacks. When blacks don't have it, its a social tragedy or validation for racism, whichever end you're at.

>>94298143
>the waitress who makes $40 an hour
Where can I get a job waiting tables that pays $40 bucks an hour?

>>94279819
God I remember spilling milk all over this strip in one of the collections and being so upset because it was my favorite as a kid.

>>94284221
Anything with Calvin's snowmen is gold. I'm still cracking up just looking at them.

>>94297585
I always wanted to cuck Calvin. Grow close to Suzie and steal her away from him around High School,.doing things for her Calvin never could.

I'd break into his house and steal his stuffed tiger he always talked to as a kid. I'd slam Suzie like there was no tomorrow, fucking her raw and constantly cumming inside of her.

As the night comes to a close and I go for the money shot on her face, I immediately push her out of the way and blast my last load onto Hobbes' face. I take photos of everything with Suzie's phone. Her cum-filled snatch and the pleasure on her face as her naked body twitches, and Calvin's stuffed tiger covered in our juices. I send the pictures to Calvin and have Suzie make me breakfast.

>>94298237
There are not words for how disappointed Mr. Rogers would be with you.

File: lunboks.jpg (11KB, 66x136px) Image search: [Google]

11KB, 66x136px

>>94285807

>>94293805
That happened to me, too and I often identified with Calvin a lot. I was frequently so bored in school that I'd read from books I'd snuck into my desk while the teacher was talking about the lessons I'd already done. The teacher was always confiscating my books, since I was supposed to be focusing on the work. That usually led to me doodling on my looseleaf instead of paying attention. One day though, I was ready for her.

After she once again caught me reading in class and took my first book, I had a back-up. So I started reading that one. She took that one, too. I had a third. The other students started laughing. When she came to take that one, she asked how many more there were. I had another two. She gave up and said that as long as my work was done well and I didn't disturb the class, I could read.

Later on, I taught myself Roman numerals and always dated my assignments with them. When it came time for the class to actually learn Roman numerals, the teacher said "Okay, everybody but anon will have a busy afternoon."

"But teacher," protested the other students. "Why do we have to learn this and anon gets to play computer games?"

"Because for the last six months he's been using what I'm about to teach you."

>>94296098
This one always gets to me.

>>94297208
Bit of an extreme reaction, but writing Hamster Huey and Gooie Kablooie just seems so wrong.
Watterson himself said that Hamster Huey, (just like The Noodle Incident) is funnier if you make it up yourself.

...at least tell me she didn't do the sequel "Commander Coriander Salamander and 'er Singlehander Bellylander" Too?

File: calvin impersonates dad.jpg (129KB, 899x288px) Image search: [Google]

129KB, 899x288px

>>94279138
Yes

File: c&h soap opera 1.png (2MB, 1658x1200px) Image search: [Google]

2MB, 1658x1200px

>>94279383
The soap opera ones were always fucking great

>>94280158
Calvin and Suzy OTP?

File: c&h soap opera 3.jpg (282KB, 900x623px) Image search: [Google]

282KB, 900x623px

>>94298883
>Hillary vs Trump. jpg

File: CH-Dad-Run.jpg (25KB, 600x197px) Image search: [Google]

25KB, 600x197px

>that sudden "... oh fuck" realization

>>94279138
No
Good parents discipline their children, when they step over the line.

>>94298176
>Work at nice supper club
>Four people out to dinner will drop $100-125 a meal easy
>Assuming they tip 15% that's $15-20
>If you wait an average of 2-3 tables an hour that's $30-60 an hour.
I never worked anywhere that nice, but I spent three years waiting tables at a local restaurant and I easily pulled in $15-25 an hour depending on how busy we were.

Shitty service is the #1 reason for poor earning in waitstaff jobs. Crappy waiters and waitresses who put in no effort and just *expect* to be tipped regardless.

>>94285391
Everyone has a high school diploma, so they become the minimum and subsequently worthless. Now we're moving into the area of everyone having a college degree, and they will become the minimum and subsequently worthless. College will effectively become the next level of high school, with the REAL college being post-graduate education. 30-40 years from now, enough people will have masters degrees that they will become the minimum and subsequently worthless. Meanwhile, the debt floor grows and grows...

>>94286260
Context?

>>94299225
This is exactly the reason why I went full masochist and went for my PhD. A bachelor's degree is practically worthless now.

>>94285946
>>94286260
the fuck

>>94286260
WHAT HAPPENS NEXT!?

>>94299231
If I had to guess, it's a parody series done in a "what if all kids had imaginary friends like hobs buthe they get bad ends.

>>94295372
We're scientists... we're not made of stone.

>>94299357
I googled it, apparently it's a Sin City esque murder mystery. The MC uses his imaginary friend to solve crimes. I'm assuming he still has him because of his childhood trauma.

>>94279138
I want to fuck calvins mom so hard, shes really hot.

>>94299390
That...actually sounds pretty badass, but I swear this sounds super familiar to something else.

>>94279214
Calvin would probably do the same shit when he becomes a dad.

File: tmp_23905-spencer_and_locke_001_main_cover_-p_2016_1-171993814.jpg (46KB, 349x524px) Image search: [Google]

46KB, 349x524px

>>94299436
"Spencer & Locke follows hard-boiled Detective Locke as he investigates a brutal murder with the strangest of partners -- his childhood imaginary panther, Spencer. But when they face brutal gunfights, deadly car chases and memories of Locke's traumatic youth, can this unlikely pair survive long enough to find the truth?"

Apparently a collected version of the entire mini-series is expected to drop late this august.

What were the best H&H strips and why were they the ones with dinosaurs?

>>94299669
Pardon me, C&H.

File: raccoon-complete-thumb1.jpg (554KB, 600x1800px) Image search: [Google]

554KB, 600x1800px

> Calvin and Hobbess thread
> No raccoon

Nope, let's fix that up.

>>94299669
I respect your opinion, however I must disagree and say that any comics with the box (be it the cloner, time machine or transmogrifier) were best.

>>94299831
>but he's not gone inside me.

As someone who lost someone recently. This is the most truest shit.

>>94298839
I like to believe Calvins Mom was like Calvin when she was little

File: 1460482641757.jpg (9KB, 150x192px) Image search: [Google]

9KB, 150x192px

>>94298839
I loved the edit thread we had of this

>>94285908
I've had mornings like that.

>>94299831
I think this got translated in Portuguese to a bird.

>>94299050
>Mister Pink here says he doesn't believe in tipping

>>94300682
European or Brazilian?

>>94301701
Brbrhuehuehue.

File: 1497018666220.png (115KB, 512x512px) Image search: [Google]

115KB, 512x512px

>>94279302
Calvin and Hobbes has always been the only newspaper comic that makes me feel warm and happy inside

>>94300103
I don't have the strip confirming that, but she was.

File: Usedtotellyou.gif (6KB, 146x188px) Image search: [Google]

6KB, 146x188px

>>94302480

>>94283540
Binoculars were precious in the 80s-90s. They cost more than many cell phones currently do. Calvin's dad was right to be pissed.

>>94279255
Well considering a lot of Republicans are creationists believe dinosaurs are a creationist hoax, I'd say Democrats would be the most pro-paleontology party

>>94279255
>implying there aren't a lot of republishits who are unironically anti-dinosaur

>>94302903
I believe the party line has expanded to that god simply populated the earth with "fossils," to provide us a sense of verisimilitude.

I don't see why dinosaurs and the Garden can't co-exist, though. They obviously occur at different points on the timeline. God was just fuckin' around and killed 'em all before draining the swamp for the Garden.

Democrats are hardly a pro-science party either, but perhaps more so than the modern neoconny GOP.

Watterson through Calvin provides a lot of top-tier political commentary.

>>94279819
This, with Watterson's commentary in one of the books it was printed in, was probably a big thing that helped me shape my opinions on what capeshit is good and what capeshit is bad.

>>94285190
And this is probably what got me so into capeshit in the first place.

>>94285164
>Calvin hits the crisis period early
Hah

>>94280158
Apparently those top two strips were "throwaways," which some newspapers would cut off to save space, so Watterson decided that he'd tell a joke that was related but inessential to the plot of the main strip.

>>94281900
v=w*r

File: AC246A22-B94C-443D-A517-CC7B3FBDAFB0-4836-00000800FACC3BFF.png (461KB, 565x486px) Image search: [Google]

461KB, 565x486px

>>94279214
>the amount of bs
Kek

>>94285946
God dammit man.

>>94302903
>Well considering a lot of Republicans are creationists
You don't actually believe that do you?
Not even most christians are creationists.
And of course both parties are pro-dinosaur look how many they have sitting on senate seats.

What do you suppose will happen if Calvin & Hobbes becomes public domain?

>>94281900
The two points have different linear velocities but the same centripetal velocity.
That being said, fuck physics, shit gave me stomach aches and insomnia from stress.

>>94279819
>Those purple textboxs in the first panel.
There's a banner for /co/

>>94284537
Doesn't he still send letters to Bill Breathed mocking him for selling out?

File: 88DBF1AB-1671-4897-A30E-43588C6EE23F-14403-000018CE3712FE9E.jpg (26KB, 553x351px) Image search: [Google]

26KB, 553x351px

>>94285946
Goddamn

>>94285391
>currently, nobody flunks school.
Thank 'No Child Left Behind'.
That said, in SC they put up with problem children until they are 16 or 17, then they mostly stop trying to find ways to catch them up and basically start encouraging them to drop out. It's a hit to the school district's stats, but supposedly not as bad as a kid failing their courses.

>>94306304
Is there any way to prevent that from happening? I really don't want to see "Sony Pictures presents: Calvin & Hobbes: The Movie" made reality.

File: 3109BD39-7695-4801-96AE-B305B337933B-23647-000027CE2216B702.jpg (45KB, 567x437px) Image search: [Google]

45KB, 567x437px

>>94299831
>"Still... In a sad, awful, terrible way, I'm happy I met him."
I have become melancholy

>>94307668
Don't worry. Disney will continue to push the public domain date back for all of eternity.

>>94279282
>His eye twitches involuntarily...
my. fucking. sides!

>>94306304
the estate will still have it under copyright so basically nothing will happen

>>94302903
the amount of repubs that are creationists is the same as the amount of libs who think vaccines cause autism, both sides have an equal percentage of idiots

>>94299831
had to put a sick pet to sleep on Friday, thanks for stabbing me in the heart again anon

>>94302408
Fuck off, Pancake Man

>>94295372
The only thing better than that is 'Thagomizer" being recognized as the name for the spikes on the end of a stegosaurus' tail.

>>94279138
So wheres the porn of his mom or the babysitter?

I taught myself to read when I was four because of Calvin and Hobbes.

>>94299610
I have been loving the shit out of this.

>>94306998
>textboxs

*textboxes

>>94299434
Why?

>>94299225
>>94299303
actually a lot of places a master won't work and short of engineering, a lot of fields now need PhDs and internships for you to even have a shot at middle class or higher job.

>>94279414
Unironically made me think

>>94279138
Wheres the porn boys?

>>94284069
>tfw when you never got to make snow sculptures

>>94295806
>I need a calculator for 9 x 7.
and you do that in fucking ALGEBRA when?

Algebra rarely if ever bothers with actual numbers, let alone such primitive things like multiplication tables.

>>94299831

This comic series was brilliant, and it'd only work with the raccoon.

They're animals that adults will associate with noises in the middle of the night and the reason their trash is all over the porch, but to a kid like Calvin it's just a sick animal that needs help. The overall message is lovely and just about as perfectly written as the rest of the comic...but fuck man, the fact that it's such a hated animal makes it so much more special to me. It really resonated with me, having owned many animals as pets that people find strange or just dirty. Like fuck you man, it may be a rat but it loves me all the same.

t. Australian who has never seen an irl raccoon

>>94298143
Normally I can just ignore /pol/ trash, but why do you need to bring it into a calvin and hobbes thread man. Come on.

>>94285700
This was one of the first examples I can remember of me becoming self aware as a kid.
I always had this nagging feeling about sundays that I didn't get until I read this

>>94295806
So was I, and now I'm working on an engineering degree.
Be very afraid.

>>94320738
Here I was trying not to be totally pessimistic.

>>94322214
>tfw when

>>94282802
The first strip was published in 1985 and Calvin was 6 years old, so he would have been in the overlap between Generation X and millennials. The Oregon Trail Generation, if you will.

But he didn't age much if at all during the strip, and certainly not in real time, so he would firmly have been a millennial for most of the strip's existence

>>94279901
I used to work in a bookstore. There's is a giant collection of everything that looks awesome.

>>94285807
>It troo! Dat darn Kahlfin stole ma spacechip!
Kek

>>94279881
Constanza, that you?

>>94282846
Because Baby boomers totally weren't a thing,Or the survivors of black plague after the renaissance, or a thousand other generational examples like >>94291625 pointed out.
.

File: images.png (4KB, 225x225px) Image search: [Google]

4KB, 225x225px

>both Calvin's parents have dark hairs
>but Calvin is blonde

Wut

>>94327078
It's not uncommon for kids to start blond and go brown as they get older.

>>94327078
Dark hair is a dominant gene.
Blond hair is a recessive gene.
If both parents have the recessive gene for blond hair there is a 25% chance Calvin would be blond.

>>94279138
God that's fuckin funny

>>94285190
What kind of powers would they have ?

>>94327078
>>94327376
If both parents were blonde and he had dark hair, there would be trouble.

>>94329088
It's still possible. Genetics are weird sometimes.

>>94279302
and then father got fired because he missed a deadline